TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T01263 XX ID T01263 XX DT 18.10.1994 (created); ewi. DT 03.03.2005 (updated); elf. CO Copyright (C), QIAGEN. XX FA hap3 XX SY CBF-A (rat); CP1a (human, rat); HAP3; NF-YB; PHP3. XX OS fission yeast, Schizosaccharomyces pombe OC Eukaryota; Fungi; Ascomycota; Archiascomycetes; Schizosaccharomycetales; Schizosaccharomycetaceae; Schizosaccharomyces. XX GE G004716 PHP3. XX CL C0030; histone fold; F4.8.1.0.2. XX SZ 116 AA; 12.9 kDa (gene) (calc.). XX SQ MSADGLDYTNLLPIANVARIMKSALPENAKISKEAKDCVQDCVSEFISFVTGEASEQCTQ SQ EKRKTITGEDVLLALNTLGFENYAEVLKISLTKYREQQARSASMKETKQSRSEEPQ XX SC Swiss-Prot#P36611 XX FT 10 75 PF00808; Histone-like transcription factor (CBF/. FT 14 78 predicted histone fold triple helix [2]. FT 14 78 PS50028; HIST_TAF. XX SF hybrid DNA-binding domain with HAP2; XX FF Transcriptional activator php3; XX IN T00348 hap2; fission yeast, Schizosaccharomyces pombe. IN T00349 Hap2p; yeast, Saccharomyces cerevisiae. IN T00351 Hap4p; yeast, Saccharomyces cerevisiae. IN T00615 NF-YA-isoform1; mouse, Mus musculus. IN T00088 NF-YA; rat, Rattus norvegicus. IN T01804 NF-YA; human, Homo sapiens. XX DR EMBL: X75072; SPRNAPHP3. DR UniProtKB: P36611; PHP3_SCHPO. XX RN [1]; RE0000549. RX PUBMED: 8223474. RA Xing Y., Fikes J. D., Guarente L. RT Mutations in yeast HAP2/HAP3 define a hybrid CCAAT box binding domain RL EMBO J. 12:4647-4655 (1993). RN [2]; RE0017971. RX PUBMED: 9662544. RA Edwards D., Murray J. A., Smith A. G. RT Multiple genes encoding the conserved CCAAT-box transcription factor complex are expressed in Arabidopsis. RL Plant Physiol. 117:1015-1022 (1998). XX //