TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T00348 XX ID T00348 XX DT 12.03.1993 (created); ewi. DT 08.01.2008 (updated); smt. CO Copyright (C), QIAGEN. XX FA hap2 XX SY CBF-B; CP1B; HAP2; NF-YA; Php2; YGL237C. XX OS fission yeast, Schizosaccharomyces pombe OC Eukaryota; Fungi; Ascomycota; Archiascomycetes; Schizosaccharomycetales; Schizosaccharomycetaceae; Schizosaccharomyces. XX CL C0030; histone fold; F4.8.1.0.1. XX SZ 334 AA; 34.9 kDa (gene) (calc.). XX SQ MNPYEPVEGLYVNAKQYHRILKRREARAKLEERLRGVQTTKKPYLHESRHKHAMRRPRGP SQ GGRFLTADKVSKLRAQEAAEAAANGGSTGDDVNATNANDATVPATVSSEVTHTSEGYADS SQ NDSRPSSISNSSESPAPINSATASMSPANNTSGNNITSPNVRGELDMSGNIAMSGGPTNT SQ ASTSGPVPHDMTVLPQTDSNTSNLMSSGSQLGSFATASTNGNNSTTTTTSSAAHPGSFHK SQ GTNDYSSTLAGNEHSAFPGLDVYHDDSVSAGAAFIPHNPMDSIDHLDVNDPTATGLPVLP SQ ASDIDPLNLTGNTQDSMIIGQQTYPSHGSSGTMK XX SC Swiss-Prot#P24488 XX FT 5 67 SM00521; CBF. FT 7 64 PF02045; CCAAT-binding transcription factor (CBF-B/N. FT 11 27 putative subunit association domain (homology to T00349) [3]. FT 44 64 putative DNA binding domain (homology to T00349) [3]. XX IN T01263 hap3; fission yeast, Schizosaccharomyces pombe. IN T00350 Hap3p; yeast, Saccharomyces cerevisiae. IN T00351 Hap4p; yeast, Saccharomyces cerevisiae. XX BS R22925. BS R00262. XX DR EMBL: M63639; SPPHP2. DR UniProtKB: P24488; PHP2_SCHPO. XX RN [1]; RE0000549. RX PUBMED: 8223474. RA Xing Y., Fikes J. D., Guarente L. RT Mutations in yeast HAP2/HAP3 define a hybrid CCAAT box binding domain RL EMBO J. 12:4647-4655 (1993). RN [2]; RE0001576. RX PUBMED: 1899284. RA Olesen J. T., Fikes J. D., Guarente L. RT The Schizosaccharomyces pombe homolog of Saccharomyces cerevisiae HAP2 reveals selective and stringent conservation of the small essential core protein domain RL Mol. Cell. Biol. 11:611-619 (1991). RN [3]; RE0017971. RX PUBMED: 9662544. RA Edwards D., Murray J. A., Smith A. G. RT Multiple genes encoding the conserved CCAAT-box transcription factor complex are expressed in Arabidopsis. RL Plant Physiol. 117:1015-1022 (1998). XX //