TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T00350 XX ID T00350 XX DT 15.10.1992 (created); ewi. DT 29.11.2012 (updated); mkl. CO Copyright (C), QIAGEN. XX FA Hap3p XX SY CBF-A (rat); CP1a (human, rat); HAP3; HAP3p; NF-YB; YBL021C. XX OS yeast, Saccharomyces cerevisiae OC Eukaryota; Fungi; Ascomycota; Hemiascomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces. XX GE G004168 HAP3. XX CL C0030; histone fold; F4.8.1.0.2. XX SZ 144 AA; 16.2 kDa (gene) (calc.). XX SQ MNTNESEHVSTSPEDTQENGGNASSSGSLQQISTLREQDRWLPINNVARLMKNTLPPSAK SQ VSKDAKECMQECVSELISFVTSEASDRCAADKRKTINGEDILISLHALGFENYAEVLKIY SQ LAKYRQQQALKNQLMYEQDDEEVP XX SC Swiss-Prot#P13434 XX FT 40 105 PF00808; Histone-like transcription factor (CBF/. FT 44 108 predicted histone fold triple helix [5]. FT 44 108 PS50028; HIST_TAF. XX SF highly conserved between S.c., S. pombe, rat, mouse; XX IN T00348 hap2; fission yeast, Schizosaccharomyces pombe. IN T00349 Hap2p; yeast, Saccharomyces cerevisiae. IN T00351 Hap4p; yeast, Saccharomyces cerevisiae. IN T00615 NF-YA-isoform1; mouse, Mus musculus. IN T00088 NF-YA; rat, Rattus norvegicus. IN T01804 NF-YA; human, Homo sapiens. XX MX M00288 F$HAP234_01. XX BS R00990. BS R02869. BS R05058. BS R00262. BS R00264. BS R24727. BS R24729. XX DR EMBL: M20318; SCHAP. DR UniProtKB: P13434; HAP3_YEAST. XX RN [1]; RE0000057. RX PUBMED: 2826015. RA Olesen J., Hahn S., Guarente L. RT Yeast HAP2 and HAP3 Activators Both Bind to the CYC1 Upstream Activation Site, UAS2, in an Interdependent Manner RL Cell 51:953-961 (1987). RN [2]; RE0000719. RX PUBMED: 2123465. RA Olesen J. T., Guarente L. RT The HAP2 subunit of yeast CCAAT transcriptional activator contains adjacent domains for subunit association and DNA recognition: model for the HAP2/3/4 complex RL Genes Dev. 4:1714-1729 (1990). RN [3]; RE0001551. RX PUBMED: 2832732. RA Hahn S., Pinkham J., Wei R., Miller R., Guarente L. RT The HAP3 regulatory locus of Saccharomyces cerevisiae encodes divergent overlapping transcripts RL Mol. Cell. Biol. 8:655-663 (1988). RN [4]; RE0002678. RX PUBMED: 2832951. RA Hahn S., Guarente L. RT Yeast HAP2 and HAP3: transcriptional activators in a heteromeric complex RL Science 240:314-321 (1988). RN [5]; RE0017971. RX PUBMED: 9662544. RA Edwards D., Murray J. A., Smith A. G. RT Multiple genes encoding the conserved CCAAT-box transcription factor complex are expressed in Arabidopsis. RL Plant Physiol. 117:1015-1022 (1998). XX //