AC T00895
XX
ID T00895
XX
DT 15.10.1992 (created); ewi.
DT 10.09.2015 (updated); jtr.
CO Copyright (C), QIAGEN.
XX
FA v-Myb
XX
SY v-Myb.
XX
OS AMV, avian myeloblastosis virus
OC viridae; ss-RNA enveloped viruses; positive strand RNA viruses; retroviridae; oncovirinae; type C oncovirus group; avian type C oncoviruses
XX
CL C0022; trp.
XX
SZ 382 AA; 43.1 kDa (gene) (calc.).
XX
SQ NRTDVQCQHRWQKVLNPELNKGPWTKEEDQRVIEHVQKYGPKRWSDIAKHLKGRIGKQCR
SQ ERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAVKNHWNSTMRR
SQ KVEQEGYPQESSKAGPPSATTGFQKSSHLMAFAHNPPAGPLPGAGQAPLGSDYPYYHIAE
SQ PQNVPGQIPYPVALHINIINVPQPAAAAIQRHYTDEDPEKEKRIKELELLLMSTENELKG
SQ QQALPTQNHTANYPGWHSTTVADNTRTSGDNAPVSCLGEHHHCTPSPPVDHGCLPEESAS
SQ PARCMIVHQSNILDNVKNLLEFAETLQLIDSFLNTSSNHENLNLDNPALTSTPVCGHKMS
SQ VTTPFHKDQTFTEYRKMHGGAV
XX
SC Swiss-Prot#P01104
XX
FT 16 67 
PS50090; MYB_3.
FT 20 69 
SM00717; sant.
FT 21 67 
PF00249; Myb-like DNA-binding domain.
FT 68 118 
PS50090; MYB_3.
FT 72 120 
SM00717; sant.
FT 73 118 
PF00249; Myb-like DNA-binding domain.
FT 152 242 
PF07988; Mitotic protein Wos2.
FT 279 300 
ATBF1-B T00048 interaction domain [15].
XX
SF <1-15: basic DNA-binding repeat 1;
SF the DNA-binding domain resides in the N-terminal part [1];
SF the DNA-binding domain interacts with the DBD of C/EBPbeta [14];
XX
FF transcriptional activator [16] [10] [13] [3];
FF oncogene, transforms myeloid and (weakly) erythroid cells [11];
FF differences between the second DNA-binding repeats of E26 and AMV cause different phenotypes of transformed cells [11];
FF lacks the regulatory phosphorylation site of c-Myb [9];
FF induces Gbx-2 T04021 expression in myeloblasts [16];
FF transcriptional activity is repressed by interaction with ATBF1-B T00048 [15];
XX
IN T00048 ATBF1-B; human, Homo sapiens.
IN T02022 C/EBPbeta; chick, Gallus gallus.
IN T05299 NR1B1; human, Homo sapiens.
XX
MX M00003 V$VMYB_01.
MX M00227 V$VMYB_02.
XX
BS R05119.
BS R05120.
BS R05121.
BS R05122.
BS R05123.
BS R05124.
BS R05125.
BS R05126.
BS R05127.
BS R05128.
BS R05129.
BS R05130.
BS R05131.
BS R05132.
BS R05133.
BS R05134.
BS R05135.
BS R05136.
BS R05137.
BS R05138.
BS R05139.
BS R05140.
BS R05141.
BS R05142.
BS R07603.
BS R07604.
BS R07605.
BS R07606.
BS R07607.
BS R07608.
BS R07609.
BS R07610.
BS R07611.
BS R07612.
BS R07613.
BS R07614.
BS R07615.
BS R07616.
BS R07617.
BS R07618.
BS R07619.
BS R07620.
BS R07621.
BS R07622.
BS R07623.
BS R07624.
BS R07625.
BS R07626.
BS R07627.
BS R07628.
BS R07629.
BS R07630.
BS R07631.
BS R01096.
BS R01097.
BS R01098.
BS R69687.
BS R69688.
BS R04710.
XX
DR TRANSPATH: MO000025250.
DR TRANSCOMPEL: C00172.
DR TRANSCOMPEL: C00554.
DR EMBL: J02012;
DR UniProtKB: P01104;
XX
RN [1]; RE0000482.
RX PUBMED: 2824190.
RA Klempnauer K.-H., Sippel A. E.
RT The highly conserved amino-terminal region of the protein encoded by the v-myb oncogene functions as a DNA-binding domain
RL EMBO J. 6:2719-2725 (1987).
RN [2]; RE0000580.
RX PUBMED: 2037048.
RA Carr M. D., Mott R. F.
RT The transcriptional control proteins c-Myb and v-Myb contain a basic region DNA binding motif
RL FEBS Lett. 282:293-294 (1991).
RN [3]; RE0001440.
RX PUBMED: 2160580.
RA Lane T., Ibanez C., Garcia A., Graf Th., Lipsick J.
RT Transformation by v-myb Correlates with trans-Activation of Gene Expression
RL Mol. Cell. Biol. 10:2591-2598 (1990).
RN [4]; RE0001835.
RX PUBMED: 3185713.
RA Biedenkapp H., Borgmeyer U., Sippel A., Klempnauer K.-H.
RT Viral myb oncogene encodes a sequence-specific DNA-binding activity
RL Nature 335:835-837 (1988).
RN [5]; RE0002110.
RX PUBMED: 2027762.
RA Bortner D. M., Ostrowski M. C.
RT Analysis of the v-myb structural components important for transactivation of gene expression
RL Nucleic Acids Res. 19:1533-1539 (1991).
RN [6]; RE0002111.
RX PUBMED: 2110653.
RA Oehler Th., Arnold H., Biedenkapp H., Klempnauer K.-H.
RT Characterization of the v-myb DNA binding domain
RL Nucleic Acids Res. 18:1703-1710 (1990).
RN [7]; RE0002237.
RX PUBMED: 2189102.
RA Kalkbrenner F., Guehmann St., Moelling K.
RT Transcriptional activation by human c-myb and v-myb genes
RL Oncogene 5:657-661 (1990).
RN [8]; RE0003514.
RX PUBMED: 8491193.
RA Burk O., Mink S., Ringwald M., Klempnauer K.-H.
RT Synergistic activation of the chicken mim-1 gene by v-myb and C/EBP transcription factors
RL EMBO J. 12:2027-2038 (1993).
RN [9]; RE0003561.
RX PUBMED: 2157164.
RA Luescher B., Christenson E., Lichtfield D. W., Krebs E. G., Eisenman R. N.
RT Myb DNA binding inhibited by phosphorylation at a site deleted during oncogenic activation
RL Nature 344:517-522 (1990).
RN [10]; RE0003587.
RX PUBMED: 2482227.
RA Klempnauer K.-H., Arnold H., Biedenkapp H.
RT Activation of transcription by v-myb: evidence for two different mechanisms
RL Genes Dev. 3:1582-1589 (1989).
RN [11]; RE0003588.
RX PUBMED: 2261644.
RA Introna M., Golay J., Frampton J., Nakano T., Ness S. A., Graf T.
RT Mutations in v-myb alter the differentiation of myelomonocytic cells transformed by the oncogene
RL Cell 63:1287-1297 (1990).
RN [12]; RE0003589.
RX PUBMED: 2835503.
RA Ibanez C. E., Lipsick J. S.
RT Structural and functional domains of the myb oncogene: requirements for nuclear transport, myeloid transformation and colony formation
RL J. Virol. 62:1981-1988 (1988).
RN [13]; RE0003590.
RX PUBMED: 2325652.
RA Ibanez C. E., Lipsick J. S.
RT Trans-activation of gene expression by v-myb
RL Mol. Cell. Biol. 10:2285-2293 (1990).
RN [14]; RE0006629.
RX PUBMED: 8657104.
RA Mink S., Kerber U., Klempnauer K.-H.
RT Interaction of C/EBPbeta and v-myb is required for synergistic activation of the mim-1 gene
RL Mol. Cell. Biol. 16:1316-1325 (1996).
RN [15]; RE0015127.
RX PUBMED: 10318867.
RA Kaspar P., Dvorakova M., Kralova J., Pajer P., Kozmik Z., Dvorak M.
RT Myb-interacting protein, ATBF1, represses transcriptional activity of Myb oncoprotein
RL J. Biol. Chem. 274:14422-14428 (1999).
RN [16]; RE0015348.
RX PUBMED: 9346236.
RA Kowenz-Leutz E., Herr P., Niss K., Leutz A.
RT The homeobox gene GBX2, a target of the myb oncogene, mediates autocrine growth and monocyte differentiation
RL Cell 91:185-195 (1997).
XX
//