TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T00910 XX ID T00910 XX DT 26.01.1993 (created); ewi. DT 01.02.2013 (updated); yre. CO Copyright (C), QIAGEN. XX FA YB-1 XX SY DbpB; YB-1. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G004962 YBX1; HGNC: YBX1. XX CL C0019; CSD. XX SZ 317 AA; 35.4 kDa (cDNA) (calc.), 52/56 kDa (SDS) [3] XX SQ MSSEAETQQPPAAPPAAPALSAADTKPGTTGSGAGSGGPGGLTSAAPAGGDKKVIATKVL SQ GTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGE SQ EAANVTGPGGVPVQGSKYAADRNHYRRYPRRRGPPRNYQQNYQNSESGEKNEGSESAPEG SQ QAQQRRPYRRRRFPPYYMRRPYGRRPQYSNPPVQGEVMEGADNQGAGEQGRPVRQNMYRG SQ YRPRFRRGPPRQRQPREDGNEEDKENQGDETQGQQPPQRRYRRNFNYRRRRPENPKPQDG SQ KETKAADPPAENSRSRG XX SC Swiss-Prot#P67809 XX FT 58 128 PF00313; 'Cold-shock' DNA-binding domain. FT 60 128 SM00357; CSP. XX SF identical to DbpB except Glu-120 (Ala in DbpB) and divergent C-terminal 4 AA [1]; SF two isoforms of 52 and 56 kDa detected in Western blots [3]; SF binds to single-stranded DNA (under multimerization) with 100 times greater affinity than to double-stranded DNA [3] [4]; XX FF binds to DNA with intrastrand cross-links between adjacent purines [7]; FF may be a Y-box binding factor [2]; FF activator, synergistic interaction with YB-1 [4]; FF expression is up-regulated by p73alpha T04931 and c-Myc:Max [5]; XX IN T00035 AP-2alphaA; human, Homo sapiens. IN T10782 Smad6; Mammalia. IN T00910 YB-1; human, Homo sapiens. XX MX M03805 V$YB1_Q3. MX M03862 V$YB1_Q4. XX BS R21569. BS R21572. BS R21575. BS R21566. BS R20986. BS R20989. BS R08882. BS R02265. XX DR TRANSPATH: MO000025262. DR EMBL: J03827; DR UniProtKB: P67809; XX RN [1]; RE0002105. RX PUBMED: 1923758. RA Hasegawa S. L., Doetsch P. W., Hamilton K. K., Martin A. M., Okenquist S. A., Lenz J., Boss J. M. RT DNA binding properties of YB-1 and dbpA: binding to double-stranded, single-stranded, and abasic site containing DNAs RL Nucleic Acids Res. 19:4915-4920 (1991). RN [2]; RE0002419. RX PUBMED: 3174636. RA Didier D. K., Schiffenbauer J., Woulfe S. L., Zacheis M., Schwartz B. D. RT Characterization of the cDNA encoding a protein binding to the major histocompatibility complex class II Y box RL Proc. Natl. Acad. Sci. USA 85:7322-7326 (1988). RN [3]; RE0014420. RX PUBMED: 9278454. RA Mertens P. R., Harendza S., Pollock A. S., Lovett D. H. RT Glomerular mesangial cell-specific transactivation of matrix metalloproteinase 2 transcription is mediated by YB-1 RL J. Biol. Chem. 272:22905-22912 (1997). RN [4]; RE0014421. RX PUBMED: 9830047. RA Mertens P. R., Alfonso-Jaume M. A., Steinmann K., Lovett D. H. RT A synergistic interaction of transcription factors AP2 and YB-1 regulates gelatinase A enhancer-dependent transcription RL J. Biol. Chem. 273:32957-32965 (1998). RN [5]; RE0024863. RX PUBMED: 12080043. RA Uramoto H., Izumi H., Ise T., Tada M., Uchiumi T., Kuwano M., Yasumoto K., Funa K., Kohno K. RT p73 Interacts with c-Myc to regulate Y-box-binding protein-1 expression. RL J. Biol. Chem. 277:31694-31702 (2002). RN [6]; RE0024865. RX PUBMED: 8657568. RA Makino Y., Ohga T., Toh S., Koike K., Okumura K., Wada M., Kuwano M., Kohno K. RT Structural and functional analysis of the human Y-box binding protein (YB-1) gene promoter. RL Nucleic Acids Res. 24:1873-1878 (1996). RN [7]; RE0048177. RX PUBMED: 9927044. RA Ise T., Nagatani G., Imamura T., Kato K., Takano H., Nomoto M., Izumi H., Ohmori H., Okamoto T., Ohga T., Uchiumi T., Kuwano M., Kohno K. RT Transcription factor Y-box binding protein 1 binds preferentially to cisplatin-modified DNA and interacts with proliferating cell nuclear antigen. RL Cancer Res. 59:342-346 (1999). XX //