TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T01072 XX ID T01072 XX DT 24.02.1994 (created); ewi. DT 22.02.2016 (updated); mkl. CO Copyright (C), QIAGEN. XX FA TEF XX SY TEF; thyrotroph embryonic factor. XX OS rat, Rattus norvegicus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G014473 Tef. XX HO VBP. XX CL C0008; bZIP. XX SZ 261 AA; 29.2 kDa (cDNA) (calc.), 45 kDa (SDS) [3] XX SQ MENPPRETRLDKEKGKEKLEEDESAAASTMAVSASLMPPIWDKTIPYDGESFHLEYMDLD SQ EFLLENGIPASPTHLAQNLLLPVAELEGKESASSSTASPPSSSTAIFQPSETVSSTESSL SQ EKERETPSPIDPNCVEVDVNFNPDPADLVLSSVPGGELFNPRKHKFAEEDLKPQPMIKKA SQ KKVFVPDEQKDEKYWTRRKKNNVAAKRSRDARRLKENQITIRAAFLEKENTALRTEVAEL SQ RKEVGKCKTIVSKYETKYGPL XX SC translated from EMBL #S58745 XX FT 189 253 SM00338; brlzneu. FT 190 243 PF07716; Basic region leucine zipper. FT 191 254 PS50217; BZIP. XX CP embryonic anterior pituitary; adult hippocampus, ventromedial nucleus of hypothalamus, piriform cortex, medial nucleus of the amygdala; 3 week: brain, heart, spleen; 21 week: lung, kidney, muscle, liver, heart, spleen, brain. XX FF activator in the developing thyrotroph [2]; FF expression varies with circadian rhythm exhibiting maximum levels in the evening and minimum levels in the morning similarly to DBP [3]; XX IN T00183 DBP; rat, Rattus norvegicus. IN T04875 DBP; human, Homo sapiens. IN T01071 Hlf; human, Homo sapiens. IN T01072 TEF; rat, Rattus norvegicus. XX MX M00672 V$TEF_Q6. MX M00228 V$VBP_01. XX BS R03919. BS R03920. BS R03921. BS R00616. BS R03922. BS R04273. XX DR TRANSPATH: MO000013484. DR EMBL: S58745; DR UniProtKB: P41224; XX RN [1]; RE0000774. RX PUBMED: 1516826. RA Hunger S. P., Ohyashiki K., Toyama K., Cleary M. L. RT Hlf, a novel hepatic bZIP protein, shows altered DNA-binding properties following fusion to E2A in t(17;19) acute lymphoblastic leukemia RL Genes Dev. 6:1608-1620 (1992). RN [2]; RE0000788. RX PUBMED: 1916262. RA Drolet D. W., Scully K. M., Simmons D. M., Wegner M., Chu K., Swanson L. W., Rosenfeld M. G. RT TEF, a transcription factor expressed specifically in the anterior pituitary during embryogenesis, defines a new class of leucine zipper proteins RL Genes Dev. 5:1739-1753 (1991). RN [3]; RE0006598. RX PUBMED: 8617210. RA Fonjallaz P., Ossipow V., Wanner G., Schibler U. RT The two PAR leucine zipper proteins, TEF and DBP, display similar circadian and tissue-specific expression, but have different target promoter preferences RL EMBO J. 15:351-362 (1996). XX //