TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T01452 XX ID T01452 XX DT 20.04.1995 (created); ewi. DT 28.08.2007 (updated); apk. CO Copyright (C), QIAGEN. XX FA v-Fos XX OS FBJ MuLV, FBJ murine osteosarcoma virus OC viridae; ss-RNA enveloped viruses; positive strand RNA viruses; retroviridae; oncovirinae; type C oncovirus group; mammalian type C oncoviruses XX CL C0008; bZIP. XX SZ 381 AA; 41.6 kDa (gene) (calc.). XX SQ MMFSGFNADYEASSFRCSSASPAGDSLSYYHSPADSFSSMGSPVNTQDFCADLSVSSANF SQ IPTVTATSTSPDLQWLVQPTLVSSVAPSQTRAPHPYGLPTQSAGAYARAEMVKTVSGGRA SQ QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDKKSALQ SQ TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEASTPESEEAFT SQ LPLLNDPEPKPSLEPVKSISNVELKAEPFDDFLFPASSRPSGSETSRSVPNVDLSGSFYA SQ ADWEPLHSNSLGMGPMVTELEPLCTPVVTCTPLLRLPELTHAAGPVSSQRRQGSRHPDVP SQ LPELVHYREEKHVFPQRFPST XX SC Swiss-Prot#P01102 XX FT 60 84 N-terminal transcription activation domain (N-TA) [6]. FT 135 199 PF00170; bZIP transcription factor. FT 135 199 SM00338; brlzneu. FT 137 200 PS50217; BZIP. XX SF the FBJ genome gives rise to a p55 v-Fos protein (in contrast to FBR) [1]; XX FF nuclear translocation appears not to be controlled by external signals (in contrast to c-Fos) [5]; FF v-Fos does not trans-repress expression of c-fos [4]; XX IN T01436 MafF; chick, Gallus gallus. IN T01437 MafG; chick, Gallus gallus. IN T01434 MafK; chick, Gallus gallus. XX DR TRANSPATH: MO000025675. DR EMBL: V01184; DR UniProtKB: P01102; XX RN [1]; RE0004798. RX PUBMED: 6283132. RA Curran T., Teich N. M. RT Candidate product of the FBJ murine osteosarcoma virus oncogene: characterization of a 55,000-Dalton phosphoprotein RL J. Virol. 42:114-122 (1982). RN [2]; RE0004799. RX PUBMED: 6292525. RA Curran T., Peters G., van Beveren C., Teich N. M., Verma I. M. RT FBJ murine osteosarcoma virus: identification and molecular cloning of biologically active proviral DNA RL J. Virol. 44:674-682 (1982). RN [3]; RE0004801. RX PUBMED: 6383726. RA Mueller R., Verma I. M. RT Expression of cellular oncogenes RL Curr. Top. Microbiol. Immunol. 112:73-115 (1984). RN [4]; RE0004803. RX PUBMED: 2513130. RA Lucibello F. C., Lowag C., Neuberg M., Mueller R. RT Trans-repression of the mouse c-fos promoter: A novel mechanism of fos-mediated trans-regulation RL Cell 59:999-1007 (1989). RN [5]; RE0004830. RX PUBMED: 2119889. RA Roux P., Blanchard J.-M., Fernandez A., Lamb N., Jeanteur P., Piechaczyk M. RT Nuclear localization of c-Fos, but not v-Fos proteins, is controlled by extracellular signals RL Cell 63:341-351 (1990). RN [6]; RE0004887. RX PUBMED: 8137828. RA Jooss K. U., Funk M., Mueller R. RT An autonomous N-terminal transactivation domain in Fos protein plays a crucial role in transformation RL EMBO J. 13:1467-1475 (1994). XX //