TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T01606 XX ID T01606 XX DT 29.11.1995 (created); ewi. DT 16.11.2007 (updated); kma. CO Copyright (C), QIAGEN. XX FA Id1.25 XX SY Id; Id1; ID125A; inhibitor of DNA-binding 1. XX OS rat, Rattus norvegicus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G014484 Id1. XX CL C0011; HLH. XX SZ 164 AA; 17.4 kDa (cDNA) (calc.). XX SQ MKVASSSAAATAGPSCSLKAGRTAGEVVLGLSEQSVAISRCAGTRLPALLDEQQVNVLLY SQ DMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVATAGGRGLPVRA SQ PLSTLNGEISALAAEVRSESEYYIILLWETKATGGGCPPYFSGA XX SC Swiss-Prot#P41135-1 XX FT 42 99 PS50888; HLH. FT 44 99 PF00010; Helix-loop-helix DNA-binding domain. FT 49 104 SM00353; finulus. XX SF no basic DNA-binding domain; SF a shorter splice variant comprises 148 AA [4] [5]; XX CP undifferentiated cells. XX FF inhibitor of bHLH proteins; FF although generally being present in undifferentiated cells, it has been found functional in pheochromocytoma cells (PC12) after induction of differentiation by NGF [2]; XX IN T00674 E47; rat, Rattus norvegicus. IN T00433 ITF-2; human, Homo sapiens. IN T00526 MyoD; mouse, Mus musculus. XX DR TRANSPATH: MO000025798. DR EMBL: L23148; DR UniProtKB: P41135-1; XX RN [1]; RE0003415. RX PUBMED: 8248126. RA Fairman R., Beran-Steed R. K., Anthony-Cahill S. J., Lear J. D., Stafford III W. F., DeGrado W. F., Benfield P. A., Brenner S. L. RT Multiple oligomeric states regulate the DNA binding of helix-loop-helix proteins RL Proc. Natl. Acad. Sci. USA 90:10429-10433 (1993). RN [2]; RE0003541. RX PUBMED: 7623812. RA Einarson M. B., Chao M. V. RT Regulation of Id1 and its association with basic helix-loop-helix proteins during nerve growth factor-induced differentiation of PC12 cells RL Mol. Cell. Biol. 15:4175-4183 (1995). RN [3]; RE0004162. RX PUBMED: 1584793. RA Kawaguchi N., DeLuca H. F., Noda M. RT Id gene expression and its suppression by 1,25-dihydroxyvitamin D3 in rat osteoblastic cells RL Proc. Natl. Acad. Sci. USA 89:4569-4572 (1992). RN [4]; RE0004166. RX PUBMED: 8106493. RA Springhorn J. P., Singh K., Kelly R.A., Smith T. W. RT Posttranscriptional regulation of Id1 activity in cardiac muscle. Alternative splicing of novel Id1 transcript permits homodimerization RL J. Biol. Chem. 269:5132-5136 (1994). RN [5]; RE0004167. RX PUBMED: 7908517. RA Nagata Y., Todokoro K. RT Activation of helix-loop-helix proteins Id1, Id2 and Id3 during neural differentiation RL Biochem. Biophys. Res. Commun. 199:1355-1362 (1994). XX //