AC T01877
XX
ID T01877
XX
DT 08.08.1996 (created); ewi.
DT 21.11.2005 (updated); ili.
CO Copyright (C), QIAGEN.
XX
FA POU4F1(l)
XX
SY Brn-3; Brn-3.0; Brn-3a; Brn-3a(l); Brn3a.
XX
OS mouse, Mus musculus
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae
XX
GE G002463 Pou4f1.
XX
CL C0007; POU.
XX
SZ 421 AA; 42.8 kDa (cDNA) (calc.).
XX
SQ MMSMNSKQPHFAMHPTLPEHKYPSLHSSSEAIRRACLPTPPLQSNLFASLDETLLARAEA
SQ LAAVDIAVSQGKSHPFKPDATYHTMNSVPCTSTSTVPLAHHHHHHHHHQALEPGDLLDHI
SQ SSPSLALMAGAGGAGAAGGGGGAHDGPGGGGGPGGGGGPGGGGPGGGGGGGGPGGGGGAP
SQ GGGLLGGSAHPHPHMHGLGHLSHPAAAAAMNMPSGLPHPGLVAAAAHHGAAAAAAAAAAG
SQ QVAAASAAAAVVGAAGLASICDSDTDPRELEAFAERFKQRRIKLGVTQADVGSALANLKI
SQ PGVGSLSQSTICRFESLTLSHNNMIALKPILQAWLEEAEGAQREKMNKPELFNGGEKKRK
SQ RTSIAAPEKRSLEAYFAVQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKFSAT
SQ Y
XX
SC translated from EMBL #S69350
XX
FT 1 84 essential for cell transformation [3].
FT 10 416 PF00478; IMP dehydrogenase / GMP reductase domain.
FT 29 66 POU-IV box [6].
FT 262 339 PF00157; Pou domain - N-terminal to homeobox domain.
FT 262 339 SM00352; pou.
FT 355 415 PS50071; HOMEOBOX_2.
FT 355 417 PS50550; POU_HOMEODOMAIN.
FT 357 419 SM00389; HOX_1.
FT 358 414 PF00046; Homeobox domain.
XX
SF POU-IV box similar to a highly conserved domain found in the N-terminus of all c-myc (e.g. T00140 T00143) family members [6];
SF unique binding properties among POU domain proteins because it binds relatively ineffectively to known octamer DNA motifs [6];
SF a shorter variant is POU4F1(s) which may arise from usage of a downstream translation initiation codon [3];
XX
CP neurogenic tissues [4]; (E13:) dorsal root ganglion, (E15.5-P8:) retinal ganglion cells, (E17:) trigeminal ganglion, (cell lines:) AtT-29, BCL1, EL-4 [6]; (E12.5-adult:) habenula, tectum, inferior olivary nucleus [7] [8] [6] [7] [8] [4].
CN (cell lines:) GC, 235, MMQ, TtT-97, P388D1 [6].
XX
FF activator [6] [1];
FF proto-oncogene because of its transforming potential [3];
FF may be involved in neuronal tissue differentiation [4];
FF maximal expression around E13.5, subsequently gradual decrease to almost undetectable levels [4];
FF transformation capability is antagonized by Brn-3b [3];
FF enhanced expression in neuronal cells by cAMP or by serum starvation [5];
FF may function in pituitary and cells of the immune system [6];
FF expression characterizes specific neurons from neurogenesis through the life of the cell which is mediated by autoregulation [7];
XX
MX M00795 V$OCT_Q6.
MX M07060 V$POU4F1_Q3.
MX M03843 V$POU4F1_Q6.
XX
BS R09973.
BS R09970.
BS R03315.
XX
DR TRANSPATH: MO000025997.
DR EMBL: S69350;
DR EMBL: X51959;
DR UniProtKB: P17208;
XX
RN [1]; RE0004225.
RX PUBMED: 7935408.
RA Morris P. J., Theil T., Ring C. J. A., Lillycrop K. A., Moroy T., Latchman D. S.
RT The opposite and antagonistic effects of the closely related POU family transcription factors Brn-3a and Brn-3b on the activity of a target promoter are dependent on differences in POU domain
RL Mol. Cell. Biol. 14:6907-6914 (1994).
RN [2]; RE0004226.
RX PUBMED: 8341591.
RA Ninkina N. N., Stevens G. E. M., Wood J. N., Richardson W. D.
RT A novel Brn3-like POU transcription factor expressed in subsets of rat sensory and spinal cord neurons
RL Nucleic Acids Res. 21:3175-3182 (1993).
RN [3]; RE0004385.
RX PUBMED: 8290353.
RA Theil T., McLean-Hunter S., Zoernig M., Moeroey T.
RT Mouse BRN-3 family of POU transcription factors: a new aminoterminal domain is crucial for the oncogenic activity of BRN-3A
RL Nucleic Acids Res. 21:5921-5929 (1993).
RN [4]; RE0004412.
RX PUBMED: 1357630.
RA Collum R. G., Fisher P. E., Datta M., Mellis S., Thiele C., Huebner K., Croce C. M., Israel M. A., Theil T., Moroy T., DePinho R., Alt F. W.
RT A novel POU homeodomain gene specifically expressed in cells of the developing mammalian nervous system
RL Nucleic Acids Res. 20:4919-4925 (1992).
RN [5]; RE0004413.
RX PUBMED: 8065921.
RA Budhram-Mahadeo V., Theil T., Morris P. J., Lillycrop K. A., Moroy T., Latchman D. S.
RT The DNA target site for the Brn-3 POU family transcription factors can confer responsiveness to cyclic AMP and removal of serum in neuronal cells
RL Nucleic Acids Res. 22:3092-3098 (1994).
RN [6]; RE0016113.
RX PUBMED: 8248179.
RA Gerrero M. R., McEvilly R. J., Turner E., Lin C. R., O'Connell S., Jenne K. J., Hobbs M. V., Rosenfeld M. G.
RT Brn-3.0: a POU-domain protein expressed in the sensory, immune, and endocrine systems that functions on elements distinct from known octamer motifs.
RL Proc. Natl. Acad. Sci. USA 90:10841-10845 (1993).
RN [7]; RE0016126.
RX PUBMED: 10414983.
RA Trieu M., Rhee J. M., Fedtsova N., Turner E. E.
RT Autoregulatory sequences are revealed by complex stability screening of the mouse brn-3.0 locus
RL J. Neurosci. 19:6549-6558 (1999).
RN [8]; RE0016131.
RX PUBMED: 8637595.
RA Erkman L., McEvilly R. J., Luo L., Ryan A. K., Hooshmand F., O'Connell S. M., Keithley E. M., Rapaport D. H., Ryan A. F., Rosenfeld M. G.
RT Role of transcription factors Brn-3.1 and Brn-3.2 in auditory and visual system development
RL Nature 381:603-606 (1996).
XX
//