TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T01877 XX ID T01877 XX DT 08.08.1996 (created); ewi. DT 21.11.2005 (updated); ili. CO Copyright (C), QIAGEN. XX FA POU4F1(l) XX SY Brn-3; Brn-3.0; Brn-3a; Brn-3a(l); Brn3a. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G002463 Pou4f1. XX CL C0007; POU. XX SZ 421 AA; 42.8 kDa (cDNA) (calc.). XX SQ MMSMNSKQPHFAMHPTLPEHKYPSLHSSSEAIRRACLPTPPLQSNLFASLDETLLARAEA SQ LAAVDIAVSQGKSHPFKPDATYHTMNSVPCTSTSTVPLAHHHHHHHHHQALEPGDLLDHI SQ SSPSLALMAGAGGAGAAGGGGGAHDGPGGGGGPGGGGGPGGGGPGGGGGGGGPGGGGGAP SQ GGGLLGGSAHPHPHMHGLGHLSHPAAAAAMNMPSGLPHPGLVAAAAHHGAAAAAAAAAAG SQ QVAAASAAAAVVGAAGLASICDSDTDPRELEAFAERFKQRRIKLGVTQADVGSALANLKI SQ PGVGSLSQSTICRFESLTLSHNNMIALKPILQAWLEEAEGAQREKMNKPELFNGGEKKRK SQ RTSIAAPEKRSLEAYFAVQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKFSAT SQ Y XX SC translated from EMBL #S69350 XX FT 1 84 essential for cell transformation [3]. FT 10 416 PF00478; IMP dehydrogenase / GMP reductase domain. FT 29 66 POU-IV box [6]. FT 262 339 PF00157; Pou domain - N-terminal to homeobox domain. FT 262 339 SM00352; pou. FT 355 415 PS50071; HOMEOBOX_2. FT 355 417 PS50550; POU_HOMEODOMAIN. FT 357 419 SM00389; HOX_1. FT 358 414 PF00046; Homeobox domain. XX SF POU-IV box similar to a highly conserved domain found in the N-terminus of all c-myc (e.g. T00140 T00143) family members [6]; SF unique binding properties among POU domain proteins because it binds relatively ineffectively to known octamer DNA motifs [6]; SF a shorter variant is POU4F1(s) which may arise from usage of a downstream translation initiation codon [3]; XX CP neurogenic tissues [4]; (E13:) dorsal root ganglion, (E15.5-P8:) retinal ganglion cells, (E17:) trigeminal ganglion, (cell lines:) AtT-29, BCL1, EL-4 [6]; (E12.5-adult:) habenula, tectum, inferior olivary nucleus [7] [8] [6] [7] [8] [4]. CN (cell lines:) GC, 235, MMQ, TtT-97, P388D1 [6]. XX FF activator [6] [1]; FF proto-oncogene because of its transforming potential [3]; FF may be involved in neuronal tissue differentiation [4]; FF maximal expression around E13.5, subsequently gradual decrease to almost undetectable levels [4]; FF transformation capability is antagonized by Brn-3b [3]; FF enhanced expression in neuronal cells by cAMP or by serum starvation [5]; FF may function in pituitary and cells of the immune system [6]; FF expression characterizes specific neurons from neurogenesis through the life of the cell which is mediated by autoregulation [7]; XX MX M00795 V$OCT_Q6. MX M07060 V$POU4F1_Q3. MX M03843 V$POU4F1_Q6. XX BS R09973. BS R09970. BS R03315. XX DR TRANSPATH: MO000025997. DR EMBL: S69350; DR EMBL: X51959; DR UniProtKB: P17208; XX RN [1]; RE0004225. RX PUBMED: 7935408. RA Morris P. J., Theil T., Ring C. J. A., Lillycrop K. A., Moroy T., Latchman D. S. RT The opposite and antagonistic effects of the closely related POU family transcription factors Brn-3a and Brn-3b on the activity of a target promoter are dependent on differences in POU domain RL Mol. Cell. Biol. 14:6907-6914 (1994). RN [2]; RE0004226. RX PUBMED: 8341591. RA Ninkina N. N., Stevens G. E. M., Wood J. N., Richardson W. D. RT A novel Brn3-like POU transcription factor expressed in subsets of rat sensory and spinal cord neurons RL Nucleic Acids Res. 21:3175-3182 (1993). RN [3]; RE0004385. RX PUBMED: 8290353. RA Theil T., McLean-Hunter S., Zoernig M., Moeroey T. RT Mouse BRN-3 family of POU transcription factors: a new aminoterminal domain is crucial for the oncogenic activity of BRN-3A RL Nucleic Acids Res. 21:5921-5929 (1993). RN [4]; RE0004412. RX PUBMED: 1357630. RA Collum R. G., Fisher P. E., Datta M., Mellis S., Thiele C., Huebner K., Croce C. M., Israel M. A., Theil T., Moroy T., DePinho R., Alt F. W. RT A novel POU homeodomain gene specifically expressed in cells of the developing mammalian nervous system RL Nucleic Acids Res. 20:4919-4925 (1992). RN [5]; RE0004413. RX PUBMED: 8065921. RA Budhram-Mahadeo V., Theil T., Morris P. J., Lillycrop K. A., Moroy T., Latchman D. S. RT The DNA target site for the Brn-3 POU family transcription factors can confer responsiveness to cyclic AMP and removal of serum in neuronal cells RL Nucleic Acids Res. 22:3092-3098 (1994). RN [6]; RE0016113. RX PUBMED: 8248179. RA Gerrero M. R., McEvilly R. J., Turner E., Lin C. R., O'Connell S., Jenne K. J., Hobbs M. V., Rosenfeld M. G. RT Brn-3.0: a POU-domain protein expressed in the sensory, immune, and endocrine systems that functions on elements distinct from known octamer motifs. RL Proc. Natl. Acad. Sci. USA 90:10841-10845 (1993). RN [7]; RE0016126. RX PUBMED: 10414983. RA Trieu M., Rhee J. M., Fedtsova N., Turner E. E. RT Autoregulatory sequences are revealed by complex stability screening of the mouse brn-3.0 locus RL J. Neurosci. 19:6549-6558 (1999). RN [8]; RE0016131. RX PUBMED: 8637595. RA Erkman L., McEvilly R. J., Luo L., Ryan A. K., Hooshmand F., O'Connell S. M., Keithley E. M., Rapaport D. H., Ryan A. F., Rosenfeld M. G. RT Role of transcription factors Brn-3.1 and Brn-3.2 in auditory and visual system development RL Nature 381:603-606 (1996). XX //