TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T01940 XX ID T01940 XX DT 05.11.1996 (created); ewi. DT 21.01.2010 (updated); pum. CO Copyright (C), QIAGEN. XX FA NF-kappaB1-isoform5 XX SY p105 carboxy-terminal region; p105 CTR; p105/pdI; p70; p70IkappaB-gamma. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G006465 Nfkb1. XX CL C0020; Rel. XX SZ 607 AA; 64.8 kDa (cDNA) (calc.), 70 kDa (SDS) [3] XX SQ MPNFSDSFGGGSGAGAGGGGMFGSGGGGGSTGSPGPGYGYSNYGFPPYGGITFHPGVTKS SQ NAGVTHGTINTKFKNGPKDCAKSDDEESLTLPEKETEGEGPSLPMACTKTEPIALASTME SQ DKEQDMGFQDNLFLEKALQLARRHANALFDYAVTGDVKMLLAVQRHLTAVQDENGDSVLH SQ LAIIHLHAQLVRDLLEVTSGLISDDIINMRNDLYQTPLHLAVITKQEDVVEDLLRVGADL SQ SLLDRWGNSVLHLAAKEGHDRILSILLKSRKAAPLIDHPNGEGLNAIHIAVMSNSLPCLL SQ LLVAAGAEVNAQEQKSGRTPLHLAVEYDNISLAGCLLLEGDAHVDSTTYDGTTPLHIAAG SQ RGSTRLAALLKAAGADPLVENFEPLYDLDDSWEKAGEDEGVVPGTTPLDMAANWQVFDIL SQ NGKPYEPVFTSDDILPQGDMKQLTEDTRLQLCKLLEIPDPDKNWATLAQKLGLGILNNAF SQ RLSPAPSKTLMDNYEVSGGTIKELMEALQQMGYTEAIEVIQAAFRTPATTASSPVTTAQV SQ HCLPLSSSSTRQHIDELRDSDSVCDSGVETSFRKLSFTESLTGDSPLLSLNKMPHGYGQE SQ GPIEGKI XX SC translated from EMBL #S89033 XX FT 72 384 PF00478; IMP dehydrogenase / GMP reductase domain. FT 174 204 SM00248; ANK_2a. FT 174 212 PF00023; Ankyrin repeat. FT 174 382 PS50297; ANK_REP_REGION. FT 213 242 SM00248; ANK_2a. FT 213 245 PF00023; Ankyrin repeat. FT 213 245 PS50088; ANK_REPEAT. FT 246 276 SM00248; ANK_2a. FT 246 278 PS50088; ANK_REPEAT. FT 246 279 PF00023; Ankyrin repeat. FT 282 311 SM00248; ANK_2a. FT 282 314 PF00023; Ankyrin repeat. FT 282 314 PS50088; ANK_REPEAT. FT 316 346 SM00248; ANK_2a. FT 316 349 PF00023; Ankyrin repeat. FT 316 349 PS50088; ANK_REPEAT. FT 350 379 SM00248; ANK_2a. FT 350 382 PF00023; Ankyrin repeat. FT 350 382 PS50088; ANK_REPEAT. FT 437 524 SM00005; DEATH_4. FT 449 524 PF00531; Death domain. FT 573 576 PKA phosphorylation site [2]. XX SF identical to the C-terminal half of the NF-kappaB1 (p105) precursor [3]; SF transcript may arise from an alternative transcription start site directing translation initiation to Met-365 of the p105 precursor [3]; SF splice variants NF-kappaB1-isoform51 and -gamma2 differ in their C-terminal sequences and lack the PKA phosphorylation site [1] [2]; SF in addition to the ankyrin repeats, the acidic region is required for NF-kappaB interaction; SF the seventh ankyrin repeat has auxiliary function [1]; SF in contrast to IkappaB-alpha, NF-kappaB1-isoform5 interacts with the p50 subunit unless the first ankyrin repeat is deleted [1]; SF the ankyrin repeats also interact with viral Tax [4]; XX CP lymphoid cells (predominantly) [3]. XX FF inhibitor of DNA-binding of NF-kappaB1 (p50) homodimers and c-Rel [3] [5]; FF controversial results on the effects on p50/p65 heterodimers [1] [3] [5]; FF prevents nuclear translocation and suppresses trans-activation by, e. g., c-Rel [3]; FF dissociates p50/DNA complexes [5]; FF gamma1 and -2 isoforms specifically act on the NF-kappaB1 (p50) subunit [1]; XX IN T01923 p50; mouse, Mus musculus. IN T00793 Tax; HTLV-I, human T-cell lymphotropic virus type I. XX MX M00194 V$NFKB_Q6. MX M00774 V$NFKB_Q6_01. XX DR TRANSPATH: MO000019317. DR EMBL: S89033; S89033. DR UniProtKB: P25799-5; XX RN [1]; RE0004615. RX PUBMED: 8183915. RA Grumont R. J., Gerondakis S. RT Alternative splicing of RNA transcripts encoded by the murine p105 NF-kappaB gene generates IkappaBgamma isoforms with different inhibitory activities RL Proc. Natl. Acad. Sci. USA 91:4367-4371 (1994). RN [2]; RE0004640. RX PUBMED: 8398903. RA Gerondakis S., Morrice N., Richadson I. B., Wettenhall R., Fecondo J., Grumont R. J. RT The activity of a 70 kilodalton I kappa B molecule identical to the carboxyl terminus of the p105 NF-kappa B precursor is modulated by protein kinase A RL Cell Growth Differ. 4:617-627 (1993). RN [3]; RE0004750. RX PUBMED: 1339305. RA Inoue J.-I., Kerr L. D., Kakizuka A., Verma I. M. RT IkappaBgamma, a 70 kd protein identical to the C-terminal half of p110 NF-kappaB: A new member of the IkappaB family RL Cell 68:1109-1120 (1992). RN [4]; RE0004751. RX PUBMED: 8170951. RA Hirai H., Suzuki T., Fujisawa J.-I., Inoue J.-I., Yoshida M. RT Tax protein of human T-cell leukemia virus type I binds to the ankyrin motifs of inhibitory factor kappaB and induces nuclear translocation of transcription factor NF-kappaB proteins for transcriptional activation RL Proc. Natl. Acad. Sci. USA 91:3584-3588 (1994). RN [5]; RE0004752. RX PUBMED: 1639070. RA Liou H.-C., Nolan G. P., Ghosh S., Fujita T., Baltimore D. RT The NF-kappaB p50 precursor, p105, contains an internal IkappaB-like inhibitor that preferentially inhibits p50 RL EMBO J. 11:3003-3009 (1992). XX //