TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T01979 XX ID T01979 XX DT 29.11.1996 (created); ewi. DT 07.03.2013 (updated); mkl. CO Copyright (C), QIAGEN. XX FA TCF-1E XX SY T-cell factor 1E. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G004674 TCF7; HGNC: TCF7. XX CL C0015; HMG; 4.1.3.0.1.11. XX SZ 511 AA; 55.3 kDa (cDNA) (calc.). XX SQ MPQLDSGGGGAGGGDDLGAPDELLAFQDEGEEQDDKSRDSAGPERDLAELKSSLVNESEG SQ AAGSAGIPGVPGAGAGARGEAEALGREHRAQRLFPDKLPEPLEDGLKAPECTSGMYKETV SQ YSAFNLLMHYPPPSGAGQHPQPQPPLHKANQPPHGVPQLSLYEHFNSPHPTPAPADISQK SQ QVHRPLQTPDLSGFYSLTSGSMGQLPHTVSWPSPPLYPLSPSCGYRQHFPAPTAAPGAPY SQ PRFTHPSLMLGSGVPGHPAAIPHPAIVPPSGKQELQPFDRNLKTQAESKAEKEAKKPTIK SQ KPLNAFMLYMKEMRAKVIAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHM SQ QLYPGWSARDNYGKKKRRSREKHQESTTDPGSPKKCRARFGLNQQTDWCGPCRRKKKCIR SQ YLPGEGRCPSPVPSDDSALGCPGSPAPQDSPSYHLLPRFPTELLTSPAEPAPTSPGLSTA SQ LSLPTPGPPQAPRSTLQSTQVQQQESQRQVA XX SC aa 1-114; 212-242; 389-511 according to ref. [3]; aa 115-211 and 243-388 translated from edited EMBL #Z47362 (inserted C between 974 and 975 according to personal communication of the authors) XX FT 1 55 beta-Catenin/ Armadillo interaction domain [4]. FT 176 359 Grg-5 interaction domain [5]. FT 298 368 SM00398; hmgende2. FT 299 372 HMG domain [5]. FT 299 367 PF00505; HMG (high mobility group) box. FT 299 367 PS50118; HMG_BOX_2. XX SF 96 putative TCF splice variants, e.g. h41TCF-1E, h44TCF-1E, h53TCF-1E, h56TCF-1E, whereby the number in front of the name, 41, 44, etc. refers to the molecular weight of the splice variant [3]; SF interaction with mGrg-5, XGrg-4 and XGrg-5 [5]; XX CP T cells. XX FF binds to beta-catenin and interacts with Grgs [5]; XX IN T03225 Grg-4; clawed frog, Xenopus laevis. IN T03224 Grg-5; clawed frog, Xenopus laevis. IN T03235 Grg-5; mouse, Mus musculus. XX MX M00978 V$LEF1TCF1_Q4. MX M00805 V$LEF1_Q2. MX M03857 V$TCF1_Q5. MX M07433 V$TCF1_Q5_01. MX M08902 V$TCF7RELATED_Q4. XX BS R03576. BS R28303. BS R28304. BS R02248. XX DR TRANSPATH: MO000026068. DR EMBL: X63901; DR EMBL: Z47362; DR EMBL: Z47365; XX RN [1]; RE0001044. RX PUBMED: 1569101. RA van de Wetering M., Oosterwegel M., Holstege F., Dooyes D., Suijkerbuijk R., van Kessel A. G., Clevers H. RT The human T cell transcription factor-1 gene. Structure, localization, and promoter characterization. RL J. Biol. Chem. 267:8530-8536 (1992). RN [2]; RE0005014. RX PUBMED: 7640309. RA Mayer K., Wolff E., Clevers H., Ballhausen W. G. RT The human high mobility group (HMG)-box transcription factor TCF-1: novel isoforms due to alternative splicing and usage of a new exon IXA RL Biochim. Biophys. Acta 1263:169-172 (1995). RN [3]; RE0012301. RX PUBMED: 8622675. RA van de Wetering M., Castrop J., Korinek V., Clevers H. RT Extensive alternative splicing and dual promoter usage generate Tcf-1 protein isoforms with differential transcription control properties RL Mol. Cell. Biol. 16:745-752 (1996). RN [4]; RE0014038. RX PUBMED: 9118222. RA van der Wetering M., Cavallo R., Dooijes D., van Beest M., van Es J., Loureiro J., Ypma A., Hursh D., Jones T., Bejsovec A., Peifer M., Mortin M., Clevers H. RT Armadillo coactivates transcription driven by the product of the drosophila segment polarity gene dTCF RL Cell 88:789-799 (1997). RN [5]; RE0014087. RX PUBMED: 9783587. RA Roose J., Molenaar M., Peterson J., Hurenkamp J., Brantjes H., Moerer P., van de Wetering M., Destree O., Clevers H. RT The Xenopus Wnt effector XTcf-3 interacts with Groucho-related transcriptional repressors RL Nature 395:608-612 (1998). XX //