TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T03224 XX ID T03224 XX DT 27.03.2000 (created); sur. DT 22.01.2004 (updated); spi. CO Copyright (C), QIAGEN. XX FA Grg-5 XX SY AES; amino enhancer split (AES); Groucho-related gene 5; XAES. XX OS clawed frog, Xenopus laevis OC eukaryota; animalia; metazoa; chordata; vertebrata; amphibia; lissamphibia; anura; archeobatrachia; pipoidea; pipidae XX SZ 197 AA; 22.0 kDa (cDNA) (calc.). XX SQ MMFPQSSSRHSGSSHMPQQLKFTTSDSCDRIKDEFQLLQAQYHSLKLECDKLAGEKSEMQ SQ RHYVMYYEMSYGLNIEMHKQAEIVKRLHGICAQVLPYLSQEHQQQVLGAIERAKQVTAPE SQ LNSIIRQLQVHQLSQLQALALPLTSLPMGLQAPSLPISASSGLLSLSALGSQGHLPKEDK SQ NGHEGDRRPDDDGDKSD XX SC translated from EMBL #U18776 XX FT 1 131 Q domain [1]. FT 2 136 PF03920; Groucho/TLE N-terminal Q-rich domain. FT 132 197 GP domain [1]. XX SF Groucho-related gene 5; SF naturally truncated Groucho-family member [1]; SF groucho T02451; SF Grg-5 lacks carboxy-terminal amino acids 198 to 766 of Grg-4 T03225 [1]; XX CP maternally expressed [2]; gastrula: mRNA in animal and vegetal region [2] [2]. XX FF interacts with Xenopus member of the TCF family of transcription factors TCF-3; FF Grg-5 derepresses a TCF reporter and potentiates Arm-TCF-3 mediated secondary axis duplication [2]; FF Grg-5 which lacks the C terminal WD40 domain enhances transcriptional activity of Armadillo-TCF-3 complexes [1]; XX IN T01979 TCF-1E; human, Homo sapiens. IN T02857 TCF-3; clawed frog, Xenopus laevis. IN T02922 TCF-A; fruit fly, Drosophila melanogaster. IN T02924 TCF-B; fruit fly, Drosophila melanogaster. XX DR TRANSPATH: MO000027171. DR EMBL: U18776; DR UniProtKB: O42470; XX RN [1]; RE0014087. RX PUBMED: 9783587. RA Roose J., Molenaar M., Peterson J., Hurenkamp J., Brantjes H., Moerer P., van de Wetering M., Destree O., Clevers H. RT The Xenopus Wnt effector XTcf-3 interacts with Groucho-related transcriptional repressors RL Nature 395:608-612 (1998). RN [2]; RE0014332. RX PUBMED: 10704855. RA Molenaar M., Brian E., Roose J., Clevers H., Destree O. RT Differential expression of the Groucho-related genes 4 and 5 during early development of Xenopus laevis RL Mech. Dev. 91:311-315 (2000). XX //