TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T02042 XX ID T02042 XX DT 27.01.1997 (created); ewi. DT 06.03.2012 (updated); mkl. CO Copyright (C), QIAGEN. XX FA CDP-isoform4 XX SY CCAAT displacement protein; CDP; CDP/Cux; Clox; cut homeodomain protein; cut-like homeodomain protein; Cux; Cux1; NF-muNR. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G002313 Cux1. XX HO cut (Drosophila). XX CL C0006; homeo. XX SZ 1332 AA; 144.3 kDa (cDNA) (calc.). XX SQ MSTTSKLEEAEHKLQTLQTALEKTRTELFDLKTKYDEETTAKADEIEMIMTDLERANQRA SQ EVAQREAETLREQLSSANHSLQLASQIQKAPDVAIEVLTRSSLEVELAAKEREIAQLVED SQ VQRLQASLTKLRENSASQISQLEQQLNAKNSTLKQLEEKLKGQADYEEVKKELNTLKSME SQ FAPSEGAGTQDSTKPLEVLLLEKNRSLQSENATLRISNSDLSGSARRKGRDQPESRRPGP SQ LPASPPPQLPRNTGEQVSNTNGTHHFSPAGLSQDFFSSNLASPSLPLASTGKFALNSLLQ SQ RQLMQSFYSKAMQEAGSTSTIFSTGPYSTNSISSPSPLQQSPDVNGMAPSPSQSESAGSI SQ SEGEEIDTAEIARQVKEQLIKHNIGQRIFGHYVLGLSQGSVSEILARPKPWNKLTVRGKE SQ PFHKMKQFLSDEQNILALRSIQGRQRENPGQSLNRLFQEVPKRRNGSEGNITTRIRASET SQ GSDEAIKSILEQAKRELQVQKTAEPVQTSSTSSSGNSDDAIRSILQQARREMEAQQAALD SQ PALKPAPLSQPDLTILTPKHLSASPMSTVSTYPPLAISLKKTPAAPETSTAALPSAPALK SQ KEAQDVPTLDPPGSADAAQGVLRPMKSELVRGSTWKDPWWSPIQPERRNLTSSEETKADE SQ TTASGKERAGSSQPRAERSQLQGPSASAEYWKEWPSAESPYSQSSELSLTGASRSETPQN SQ SPLPSSPIVPMAKPAKPSVPPLTPEQYEVYMYQEVDTIELTRQVKEKLAKNGICQRIFGE SQ KVLGLSQGSVSDMLSRPKPWSKLTQKGREPFIRMQLWLNGELGQGVLPVQGQQQGPVLHS SQ VASLQDPLQQGCVSSESTPKTSASCSPAPESPMSSSESVKSLTELVQQPCPAIETSKEGK SQ PPEPSDPPASDSQPTTPLPLSGHSALSIQELVAMSPELDTYGITKRVKEVLTDNNLGQRL SQ FGETILGLTQGSVSDLLARPKPWHKLSLKGREPFVRMQLWLNDPNNVEKLMDMKRMEKKA SQ YMKRRHSSVSDSQPCEPPSVGIDYSQGASPQPQHQLKKPRVVLAPEEKEALKRAYQQKPY SQ PSPKTIEELATQLNLKTSTVINWFHNYRSRIRRELFIEEIQAGSQGQAGASDSPSARSSR SQ AAPSSEGDSCDGVEATDAEEPGGNIVATKSQGGLAEVAAAPADREEATQPAEKAKAQPLC SQ SGTPGQDDGEDASRPRPLPEGLADAPAPVPSLAAPAAGEDAATSATAPATATEAPGAARA SQ GPAERSSALPSTSAPANAPARRPSSLQSLFGLPEAAAARDNPVRKKKAANLNSIIHRLEK SQ AASREEPIEWEF XX SC translated from EMBL #X75013 XX FT 68 542 PF00478; IMP dehydrogenase / GMP reductase domain. FT 357 444 PF02376; CUT domain. FT 357 444 PS51042; CUT. FT 746 833 PF02376; CUT domain. FT 746 833 PS51042; CUT. FT 929 1016 PF02376; CUT domain. FT 929 1016 PS51042; CUT. FT 1054 1114 PS50071; HOMEOBOX_2. FT 1055 1115 PS50560; CUT_HOMEODOMAIN. FT 1056 1118 SM00389; HOX_1. FT 1057 1113 PF00046; Homeobox domain. XX SF alternatively spliced form T01083 [5]; SF CDP-isoform4 and Cutl2 T04456 are linked on distal chromosome 5 with an interval of 2.4-13.7 cM [7]; XX CP conflicting results for expression in skeletal muscle: + [2] or - [3] [2] [3]. EX brain,,,Theiler Stage 23; medium; Western blot; protein; [3]. EX brain,,,adult; high; Western blot; protein; [3]. EX cartilage,,,Theiler Stage 23; medium; Western blot; protein; [3]. EX cartilage,,,adult; none; Western blot; protein; [3]. EX choroid plexus of telencephalon,,,Theiler Stage 23; detectable; immunohistochemistry / immunocytochemistry; protein; [3]. EX costal cartilage,chondrocyte,,Theiler Stage 23; detectable; immunohistochemistry / immunocytochemistry; protein; [3]. EX heart,,,Theiler Stage 23; low; Western blot; protein; [3]. EX heart,,,adult; high; Western blot; protein; [3]. EX inner chondrogenic layer,,,Theiler Stage 23; detectable; immunohistochemistry / immunocytochemistry; protein; [3]. EX lens,anuclear cell,,Theiler Stage 23; none; immunohistochemistry / immunocytochemistry; protein; [3]. EX liver,,,Theiler Stage 23; low; Western blot; protein; [3]. EX liver,,,adult; none; Northern blot; total RNA; [2]. EX liver,,,adult; none; Western blot; protein; [3]. EX lung,,,Theiler Stage 23; high; Western blot; protein; [3]. EX lung,,,adult; high; Western blot; protein; [3]. EX mouse, Mus musculus,,,Theiler Stage 11; low; Northern blot; total RNA; [2]. EX mouse, Mus musculus,,,Theiler Stage 13; very low; Northern blot; total RNA; [2]. EX mouse, Mus musculus,,,Theiler Stage 15; low; Northern blot; total RNA; [2]. EX mouse, Mus musculus,,,Theiler Stage 16; very low; Western blot; protein; [3]. EX mouse, Mus musculus,,,Theiler Stage 17; high; Northern blot; total RNA; [2]. EX mouse, Mus musculus,,,Theiler Stage 19; very high; Northern blot; total RNA; [2]. EX mouse, Mus musculus,,,Theiler Stage 20; medium; Western blot; protein; [3]. EX mouse, Mus musculus,,,Theiler Stage 20; very high; Northern blot; total RNA; [2]. EX mouse, Mus musculus,,,Theiler Stage 21; medium; Western blot; protein; [3]. EX mouse, Mus musculus,,,Theiler Stage 22; high; Northern blot; total RNA; [2]. EX mouse, Mus musculus,,,Theiler Stage 23; high; Northern blot; total RNA; [2]. EX mouse, Mus musculus,,,Theiler Stage 24; medium; Northern blot; total RNA; [2]. EX mouse, Mus musculus,,,Theiler Stage 25; medium; Northern blot; total RNA; [2]. EX mouse, Mus musculus,,,Theiler Stage 26; medium; Northern blot; total RNA; [2]. EX mouse, Mus musculus,,,Theiler Stage 27; low; Northern blot; total RNA; [2]. EX mouse, Mus musculus,,,Theiler Stage 7; very low; Northern blot; total RNA; [2]. EX mouse, Mus musculus,,,Theiler Stage 9; very low; Northern blot; total RNA; [2]. EX muscles,,,Theiler Stage 23; medium; Western blot; protein; [3]. EX muscles,,,adult; none; Western blot; protein; [3]. EX spinal cord,,,Theiler Stage 23; detectable; immunohistochemistry / immunocytochemistry; protein; [3]. EX telencephalon,,,Theiler Stage 23; detectable; immunohistochemistry / immunocytochemistry; protein; [3]. XX FF transcription factor, look up the TRANSFAC cross reference for more details; FF transcriptional repressor [1]; FF strong inhibitor of the NCAM (neural cell adhesion molecule) promoter but inhibition is relieved by Phox-2 T02090 [2]; FF may bind to matrix attached regions (S/MARs) [4]; FF maximal expression during embryogenesis around Theiler stages 19-20 [2]; XX MX M00104 V$CDPCR1_01. MX M00106 V$CDPCR3HD_01. MX M00105 V$CDPCR3_01. MX M00095 V$CDP_01. MX M00102 V$CDP_02. MX M01342 V$CDP_03. MX M01344 V$CDP_04. MX M04610 V$CDP_Q6_01. XX BS R03477. BS R00562. BS R01677. XX DR TRANSPATH: MO000026114. DR SMARTDB: SB000025. DR EMBL: X75013; DR UniProtKB: P53564-4; XX RN [1]; RE0000346. RX PUBMED: 3181130. RA Superti-Furga G., Barberis A., Schaffner G., Busslinger M. RT The -117 mutation in Greek HPFH affects the binding of three nuclear factors to the CCAAT region of the gamma-globin gene RL EMBO J. 7:3099-3107 (1988). RN [2]; RE0004999. RX PUBMED: 7910552. RA Valarche T. S., Tissier-Seta J. P., Hirsch M. R., Martinez S. F., Goridis C., Brunet J. F. RT The Mouse homeodomain protein Phox2 regulates NCAM promoter activity in concert with CUX/CDP and is a putative determinant of neurotransmitter phenotype RL Development 119:881-896 (1993). RN [3]; RE0005001. RX PUBMED: 1363085. RA Andres V., Nadal-Ginard B., Mahdavi V. RT Clox, a mammalian homeobox gene related to Drosophila cut, encodes DNA-binding regulatory proteins differentially expressed during development RL Development 116:321-334 (1992). RN [4]; RE0007081. RX PUBMED: 9218488. RA Banan M., Rojas I. C., Lee W. H., King H. L., Harriss J.V., Kobayashi R., Web C. F., Gottlieb P. D. RT Interaction of the nuclear matrix-associated region (MAR)-binding proteins, SATB1 and CDP/Cux, with a MAR element (L2a) in an upstream regulatory region of the mouse CD8a gene RL J. Biol. Chem. 272:18440-18452 (1997). RN [5]; RE0013403. RX PUBMED: 9858552. RA Wang Z., Goldstein A., Zong R. T., Lin D., Neufeld E. J., Scheuermann R. H., Tucker P. W. RT Cux/CDP homeoprotein is a component of NF-muNR and represses the immunoglobulin heavy chain intronic enhancer by antagonizing the bright transcription activator RL Mol. Cell. Biol. 19:284-295 (1999). RN [6]; RE0015033. RX PUBMED: 9792700. RA Chattopadhyay S., Whitehurst C. E., Chen J. RT A nuclear matrix attachment region upstream of the T cell receptor beta gene enhancer binds Cux/CDP and SATB1 and modulates enhancer-dependent reporter gene expression but not endogenous gene expression RL J. Biol. Chem. 273:29838-29846 (1998). RN [7]; RE0016102. RX PUBMED: 8798433. RA Quaggin S. E., Heuvel G. B., Golden K., Bodmer R., Igarashi P. RT Primary structure, neural-specific expression, and chromosomal localization of Cux-2, a second murine homeobox gene related to Drosophila cut. RL J. Biol. Chem. 271:22624-22634 (1996). RN [8]; RE0048974. RX PUBMED: 8798762. RA Coqueret O., Berube G., Nepveu A. RT DNA binding by cut homeodomain proteins is down-modulated by protein kinase C. RL J. Biol. Chem. 271:24862-24868 (1996). XX //