TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T02977 XX ID T02977 XX DT 22.02.2000 (created); sur. DT 30.06.2004 (updated); spi. CO Copyright (C), QIAGEN. XX FA armadillo XX SY 86E4.6; Arm; Armadillo segment polarity protein; EG:86E4.6. XX OS fruit fly, Drosophila melanogaster OC eukaryota; animalia; metazoa; arthropoda; insecta; diptera; drosophiloidea; drosophilidae XX HO beta-catenin. XX SZ 843 AA; 91.1 kDa (cDNA) (calc.). XX SQ MSYMPAQNRTMSHNNQYNPPDLPPMVSAKEQTLMWQQNSYLGDSGIHSGAVTQVPSLSGK SQ EDEEMEGDPLMFDLDTGFPQNFTQDQVDDMNQQLSQTRSQRVRAAMFPETLEEGIEIPST SQ QFDPQQPTAVQRLSEPSQMLKHAVVNLINYQDDAELATRAIPELIKLLNDEDQVVVSQAA SQ MMVHQLSKKEASRHAIMNSPQMVAALVRAISNSNDLESTKAAVGTLHNLSHHRQGLLAIF SQ KSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVTLLQRNNVK SQ FLAIVTDCLQILAYGNQESKLIILASGGPNELVRIMRSYDYEKLLWTTSRVLKVLSVCSS SQ NKPAIVDAGGMQALAMHLGNMSPRLVQNCLWTLRNLSDAATKVEGLEALLQSLVQVLGST SQ DVNVVTCAAGILSNLTCNNQRNKATVCQVGGVDALVRTIINAGDREEITEPAVCALRHLT SQ SRHVDSELAQNAVRLNYGLSVIVKLLHPPSRWPLIKAVIGLIRNLALCPANHAPLREHGA SQ IHHLVRLLMRAFQDTERQRSSIATTGSQQPSAYADGVRMEEIVEGTVGALHILARESHNR SQ ALIRQQSVIPIFVRLLFNEIENIQRVAAGVLCELAADKEGAEIIEQEGATGPLTDLLHSR SQ NEGVATYAAAVLFRMSEDKPQDYKKRLSIELTNSLLREDNNIWANADLGMGPDLQDMLGP SQ EEAYEGLYGQGPPSVHSSHGGRAFHQQGYDTLPIDSMQGLEISSPVGGGGAGGAPGNGGA SQ VGGASGGGGNIGAIPPSGAPTSPYSMDMDVGEIDAGALNFDLDAMPTPPNDNNNLAAWYD SQ TDC XX SC PIR #T12689 XX FT 44 322 PF00478; IMP dehydrogenase / GMP reductase domain. FT 149 188 SM00185; arm_5. FT 159 200 armadillo repeat 1 [1]. FT 159 199 PS50176; ARM_REPEAT. FT 189 231 PF00514; Armadillo/beta-catenin-like repeat. FT 189 231 SM00185; arm_5. FT 201 242 armadillo repeat 2 [1]. FT 201 244 PS50176; ARM_REPEAT. FT 232 272 PF00514; Armadillo/beta-catenin-like repeat. FT 232 272 SM00185; arm_5. FT 243 284 armadillo repeat 3 [1]. FT 243 285 PS50176; ARM_REPEAT. FT 273 314 SM00185; arm_5. FT 285 326 armadillo repeat 4 [1]. FT 285 327 PS50176; ARM_REPEAT. FT 316 357 SM00185; arm_5. FT 327 368 armadillo repeat 5 [1]. FT 327 370 PS50176; ARM_REPEAT. FT 358 398 PF00514; Armadillo/beta-catenin-like repeat. FT 358 398 SM00185; arm_5. FT 369 410 armadillo repeat 6 [1]. FT 402 437 PF00514; Armadillo/beta-catenin-like repeat. FT 402 437 SM00185; arm_5. FT 408 450 PS50176; ARM_REPEAT. FT 411 449 armadillo repeat 7 [1]. FT 438 481 SM00185; arm_5. FT 439 481 PF00514; Armadillo/beta-catenin-like repeat. FT 450 496 armadillo repeat 8 [1]. FT 450 483 PS50176; ARM_REPEAT. FT 485 527 SM00185; arm_5. FT 497 538 armadillo repeat 9 [1]. FT 497 540 PS50176; ARM_REPEAT. FT 528 595 SM00185; arm_5. FT 539 584 armadillo repeat 10 [1]. FT 585 608 1/2 armadillo repeat 11 [1]. FT 596 636 PF00514; Armadillo/beta-catenin-like repeat. FT 596 636 SM00185; arm_5. FT 607 649 PS50176; ARM_REPEAT. FT 609 647 armadillo repeat 12 [1]. FT 637 677 PF00514; Armadillo/beta-catenin-like repeat. FT 637 677 SM00185; arm_5. FT 648 689 armadillo repeat 13 [1]. XX SF belongs to the beta-catenin family; SF 6 exons, 2 classes of mRNA differing in exon 1 encoding the same protein; SF loss of arm function produces anterior-type denticles in the posterior naked cuticle region of each segment; SF most armadillo repeats are 42 aa long and a consensus sequence can be formed at 25 of the 42 positions; SF each repeat consists of a series of four short, structured, hydrophobic regions separated by four polar turn regions [1]; SF armadillo repeats are also found in APC, beta-catenin, plakoglobin (gamma-catenin), importin and other proteins [2]; XX CP present in virtually all of the cell types contained in embryo, third-instar larvae and adult ovaries [1]. XX FF may be involved in transmitting or interpreting patterning information on the inside of the cell; FF armadillo is needed for pattern formation processes [1]; XX IN T00930 LEF-1; mouse, Mus musculus. IN T02922 TCF-A; fruit fly, Drosophila melanogaster. IN T02924 TCF-B; fruit fly, Drosophila melanogaster. XX DR TRANSPATH: MO000026928. DR EMBL: X54468; DR UniProtKB: P18824; XX RN [1]; RE0014173. RX PUBMED: 2707602. RA Riggleman B., Wieschaus E., Schedl P. RT Molecular analysis of the armadillo locus: uniformly distributed transcripts and a protein with novel internal repeats are associated with a Drosophila segment polarity gene RL Genes Dev. 3:96-113 (1989). RN [2]; RE0014350. RX PUBMED: 7907279. RA Peifer M., Berg S., Reynolds A. B. RT A repeating amino acid motif shared by proteins with diverse cellular roles RL Cell 76:789-791 (1994). XX //