TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T04100 AS T04120. XX ID T04100 XX DT 11.12.2000 (created); rio. DT 08.01.2013 (updated); ili. CO Copyright (C), QIAGEN. XX FA FoxH1 XX SY Fast-1; FAST-2; FAST1; FAST2; Fork head activin signal transducer 2; forkhead activin signal transducer 1; forkhead activin signal transducer 2; forkhead box H1; FOXH1; FoxH1-Long. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G002448 Foxh1. XX CL C0023; fork head. XX SZ 401 AA; 44.0 kDa (cDNA) (calc.). XX SQ MASGWDLASTYTPTTPSPQLALAPAQGYLPCMGPRDNSQLRPPEAESLSKTPKRRKKRYL SQ RHDKPPYTYLAMIALVIQAAPFRRLKLAQIIRQVQAVFPFFRDDYEGWKDSIRHNLSSNR SQ CFHKVPKDPAKPQAKGNFWAVDVSLIPAEALRLQNTALCRRWQNRGTHRAFAKDLSPYVL SQ HGQPYQPPSPPPPPREGFSIKSLLGDLGKESTWPKHPGLLGQSTAAQAGTLSKGEEGMGT SQ GPSSSSETPLWPLCSLPGPTIIEGESSQGEVIRPSPVTPDQGSWPLHLLEDSADSRGVPR SQ RGSRASLWGQLPTSYLPIYTPNVVMPLATLPTTSCPQCPSSASPAYWSVGTESQGSQDLL SQ CDLDSLFQGVPPNKSIYDVWVSHPRDLAAPAPGWLLSWYSM XX SC translated from EMBL #AF110506 XX FT 62 152 SM00339; forkneu4. FT 63 164 fork head domain [6]. FT 64 163 PS50039; FORK_HEAD_3. FT 64 165 PF00250; Fork head domain. FT 70 78 helix alpha 1 [6]. FT 87 97 helix alpha 2 [6]. FT 100 104 helix alpha 4 [6]. FT 109 119 helix alpha 3 [6]. FT 123 125 strand beta 1 [6]. FT 138 140 strand beta 2 [6]. FT 149 155 helix alpha 5 [6]. XX SF low degree of amino acid identity to FoxH1 (=Fast-1) of other species T04135 T04119 outside the DNA binding domain [3]; SF SMAD-2 T04095 dependent interaction with TGIF T04076 to a Fast-SMAD-TGIF complex [2]; SF interaction with SMAD-3 [1]; XX EX mouse, Mus musculus,,,Theiler Stage 11; high; RT-PCR; total RNA; [4]. EX mouse, Mus musculus,,,Theiler Stage 13; medium; RT-PCR; total RNA; [4]. EX mouse, Mus musculus,,,Theiler Stage 15; low; RT-PCR; total RNA; [4]. EX mouse, Mus musculus,,,Theiler Stage 17; very low; RT-PCR; total RNA; [4]. EX mouse, Mus musculus,,,Theiler Stage 19; none; RT-PCR; total RNA; [4]. EX mouse, Mus musculus,,,Theiler Stage 21; none; RT-PCR; total RNA; [4]. EX mouse, Mus musculus,,,Theiler Stage 9; very high; RT-PCR; total RNA; [4]. XX FF functions to specify the anterior primitive streak [7]; FF is essential for development of the anterior heart field [5]; FF a complex is formed in response to TGF-beta treatment which binds to ARE (Activin Response Element) and includes at least three proteins, FAST-2, SMAD-2 and SMAD-4 [1]; XX IN T04095 Smad2-L; human, Homo sapiens. XX MX M03822 V$FOXH1_Q6. MX M00809 V$FOX_Q2. XX BS R23042. BS R73969. BS R19513. BS R09916. BS R09935. XX DR TRANSPATH: MO000028003. DR TRANSCOMPEL: C00201. DR EMBL: AF110506; DR EMBL: AF177770; DR UniProtKB: O88621-1; XX RN [1]; RE0013366. RX PUBMED: 9858566. RA Liu B., Dou C. L., Prabhu L., Lai E. RT FAST-2 is a mammalian winged-helix protein which mediates transforming growth factor beta signals RL Mol. Cell. Biol. 19:424-430 (1999). RN [2]; RE0015456. RX PUBMED: 10199400. RA Wotton D., Lo R. S., Lee S., Massague J. RT A Smad transcriptional corepressor RL Cell 97:29-39 (1999). RN [3]; RE0015505. RX PUBMED: 10349617. RA Weisberg E., Winnier G. E., Chen X., Farnsworth C. L., Hogan B. L., Whitman M. RT A mouse homologue of FAST-1 transduces TGF beta superfamily signals and is expressed during early embryogenesis RL Mech. Dev. 79:17-27 (1998). RN [4]; RE0016391. RX PUBMED: 9702197. RA Labbe E., Silvestri C., Hoodless P. A., Wrana J. L., Attisano L. RT Smad2 and Smad3 positively and negatively regulate TGF beta-dependent transcription through the forkhead DNA-binding protein FAST2. RL Mol. Cell 2:109-120 (1998). RN [5]; RE0034277. RX PUBMED: 15363409. RA von Both I., Silvestri C., Erdemir T., Lickert H., Walls J. R., Henkelman R. M., Rossant J., Harvey R. P., Attisano L., Wrana J. L. RT Foxh1 is essential for development of the anterior heart field. RL Dev. Cell 7:331-45 (2004). RN [6]; RE0047915. RX PUBMED: 11179011. RA Saleem R. A., Banerjee-Basu S., Berry F. B., Baxevanis A. D., Walter M. A. RT Analyses of the effects that disease-causing missense mutations have on the structure and function of the winged-helix protein FOXC1. RL Am. J. Hum. Genet. 68:627-641 (2001). RN [7]; RE0048314. RX PUBMED: 11358869. RA Hoodless P. A., Pye M., Chazaud C., Labbe E., Attisano L., Rossant J., Wrana J. L. RT FoxH1 (Fast) functions to specify the anterior primitive streak in the mouse. RL Genes Dev. 15:1257-1271 (2001). XX //