TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T04128 XX ID T04128 XX DT 19.12.2000 (created); rio. DT 30.07.2014 (updated); mkl. CO Copyright (C), QIAGEN. XX FA PBX3b XX SY Pbx3b; pre B-cell leukemia transcription factor 3b. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G002139 PBX3; HGNC: PBX3. XX CL C0006; homeo; 3.1.4.4.3.2. XX SZ 351 AA; 38.8 kDa (cDNA) (calc.). XX SQ MDDQSRMLQTLAGVNLAGHSVQGGMALPPPPHGHEGADGDGRKQDIGDILHQIMTITDQS SQ LDEAQAKKHALNCHRMKPALFSVLCEIKEKTGLSIRGAQEEDPPDPQLMRLDNMLLAEGV SQ SGPEKGGGSAAAAAAAAASGGSSDNSIEHSDYRAKLTQIRQIYHTELEKYEQACNEFTTH SQ VMNLLREQSRTRPISPKEIERMVGIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRR SQ NFSKQATEILNEYFYSHLSNPYPSEEAKEELAKKCSITVSQVSNWFGNKRIRYKKNIGKF SQ QEEANLYAAKTAVTAAHAVAAAVQNNQTNSPTTPNSGGYPPSCYQSDGRLQ XX SC Swiss-Prot#P40426-2 XX FT 34 234 PF03792; PBX domain. FT 233 296 PS50071; HOMEOBOX_2. FT 235 300 SM00389; HOX_1. FT 236 295 PF00046; Homeobox domain. XX SF TALE (three amino acid loop extension) homeo domain superclass [2]; SF 84% and 77% similarity to Pbx-1T01481 T02087 and Pbx-2 T04123 [1]; XX EX adrenal gland (right and left),,,fetal; low; RT-PCR; total RNA; [1]. EX adrenal gland (right and left),,,fetal; none; Northern blot; mRNA (poly-A); [1]. EX blood,basophil granulocyte,Circulatory System & Hematopoietic System,adult; medium; Northern blot; mRNA (poly-A); [1]. EX blood,eosinophil granulocyte,Circulatory System & Hematopoietic System,adult; medium; Northern blot; mRNA (poly-A); [1]. EX blood,lymphocyte,Circulatory System & Hematopoietic System,adult; medium; Northern blot; mRNA (poly-A); [1]. EX blood,monocyte,Circulatory System & Hematopoietic System,adult; medium; Northern blot; mRNA (poly-A); [1]. EX blood,neutrophil granulocyte,Circulatory System & Hematopoietic System,adult; medium; Northern blot; mRNA (poly-A); [1]. EX brain,,,fetal; low; Northern blot; mRNA (poly-A); [1]. EX brain,,,fetal; very low; RT-PCR; total RNA; [1]. EX gut,,,fetal; low; Northern blot; mRNA (poly-A); [1]. EX heart,,,adult; medium; Northern blot; mRNA (poly-A); [1]. EX heart,,,fetal; low; RT-PCR; total RNA; [1]. EX heart,,,fetal; medium; Northern blot; mRNA (poly-A); [1]. EX kidney (right and left),,,adult; medium; Northern blot; mRNA (poly-A); [1]. EX kidney (right and left),,,fetal; high; RT-PCR; total RNA; [1]. EX kidney (right and left),,,fetal; low; Northern blot; mRNA (poly-A); [1]. EX liver,,,fetal; high; RT-PCR; total RNA; [1]. EX liver,,,fetal; low; Northern blot; mRNA (poly-A); [1]. EX lung (right and left),,,fetal; high; RT-PCR; total RNA; [1]. EX lung (right and left),,,fetal; low; Northern blot; mRNA (poly-A); [1]. EX ovary (right and left),,,adult; very high; Northern blot; mRNA (poly-A); [1]. EX spleen,,,fetal; medium; Northern blot; mRNA (poly-A); [1]. EX thymus,,,adult; medium; Northern blot; mRNA (poly-A); [1]. EX thymus,,,fetal; medium; Northern blot; mRNA (poly-A); [1]. EX tonsil,,,adult; medium; Northern blot; mRNA (poly-A); [1]. EX uterus,,,adult; medium; Northern blot; mRNA (poly-A); [1]. XX MX M00998 V$PBX_Q3. MX M07304 V$PBX_Q5. XX BS R15380. XX DR TRANSPATH: MO000028031. DR UniProtKB: P40426-2; XX RN [1]; RE0005181. RX PUBMED: 1682799. RA Monica K., Saltman D., Nourse J., Galili N., Cleary M. L. RT PBX2 and PBX3, new homeobox genes with extensive homology to the human proto-oncogene PBX1 RL Mol. Cell. Biol. 11:6149-6157 (1991). RN [2]; RE0014544. RX PUBMED: 9336443. RA Burglin T. R. RT Analysis of TALE superclass homeobox genes (MEIS, PBC, KNOX, Iroquois, TGIF) reveals a novel domain conserved between plants and animals RL Nucleic Acids Res. 25:4173-4180 (1997). RN [3]; RE0024570. RX PUBMED: 8183558. RA LeBrun D. P., Cleary M. L. RT Fusion with E2A alters the transcriptional properties of the homeodomain protein PBX1 in t(1;19) leukemias. RL Oncogene 9:1641-1647 (1994). XX //