
AC T01481
XX
ID T01481
XX
DT 04.05.1995 (created); ewi.
DT 30.09.2015 (updated); jmh.
CO Copyright (C), QIAGEN.
XX
FA Pbx1a
XX
SY Pbx-1; Pbx1; pre B-cell leukemia transcription factor 1a; Prl.
XX
OS human, Homo sapiens
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates
XX
GE G002135 PBX1; HGNC: Pbx1.
XX
HO Exd (Drosophila), MATa1 (yeast), ceh-20 (C. elegans).
XX
CL C0006; homeo; 3.1.4.4.1.1.
XX
SZ 430 AA; 46.6 kDa (cDNA) (calc.).
XX
SQ MDEQPRLMHSHAGVGMAGHPGLSQHLQDGAGGTEGEGGRKQDIGDILQQIMTITDQSLDE
SQ AQARKHALNCHRMKPALFNVLCEIKEKTVLSIRGAQEEEPTDPQLMRLDNMLLAEGVAGP
SQ EKGGGSAAAAAAAAASGGAGSDNSVEHSDYRAKLSQIRQIYHTELEKYEQACNEFTTHVM
SQ NLLREQSRTRPISPKEIERMVSIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNF
SQ NKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQE
SQ EANIYAAKTAVTATNVSAHGSQANSPSTPNSAGSSSSFNMSNSGDLFMSVQSLNGDSYQG
SQ AQVGANVQSQVDTLRHVISQTGGYSDGLAASQMYSPQGISANGGWQDATTPSSVTSPTEG
SQ PGSVHSDTSN
XX
SC Swiss-Prot#P40424-1
XX
FT 1 140
PKNOX1 T04122 interaction domain [15].
FT 33 232
PF03792; PBX domain.
FT 86 405
PF00478; IMP dehydrogenase / GMP reductase domain.
FT 119 233
blocks DNA binding [17].
FT 231 294
PS50071; HOMEOBOX_2.
FT 233 430
sufficient for DNA binding [17].
FT 233 298
SM00389; HOX_1.
FT 234 293
PF00046; Homeobox domain.
FT 347 430
transactivation domain [11].
XX
SF divergent homeo domain, most similar to yeast MATa1 [10];
SF TALE (three amino acid loop extension) homeo domain superclass [12];
SF co-factor for many, but not all homeo domain proteins [7] [8];
SF cooperative binding with Meis-1 T03388 T04129 and PKNOX1 T04122 which is disrupted in the oncoprotein E2A-Pbx1 [14] [15];
SF subunit of the UEF-3 T02839 complex [13];
SF interacts DNA independently with PKNOX1 T04122 and increases binding affinity [13] [15];
SF PKNOX1-Pbx-1 complexes are present during mouse embryogenesis [15];
SF mediates DNA dependent ternary complex with HOXB1 T01719 and PKNOX1 T04122 [15] [11];
XX
CN (cell lines:) lymphoid cells, B- and T-cell lineages.
EX adrenal gland (right and left),,,fetal; high; Northern blot; mRNA (poly-A); [10].
EX blood,basophil granulocyte,Circulatory System & Hematopoietic System,adult; low; Northern blot; mRNA (poly-A); [10].
EX blood,eosinophil granulocyte,Circulatory System & Hematopoietic System,adult; low; Northern blot; mRNA (poly-A); [10].
EX blood,lymphocyte,Circulatory System & Hematopoietic System,adult; low; Northern blot; mRNA (poly-A); [10].
EX blood,monocyte,Circulatory System & Hematopoietic System,adult; low; Northern blot; mRNA (poly-A); [10].
EX blood,neutrophil granulocyte,Circulatory System & Hematopoietic System,adult; low; Northern blot; mRNA (poly-A); [10].
EX brain,,,fetal; very high; Northern blot; mRNA (poly-A); [10].
EX gut,,,fetal; medium; Northern blot; mRNA (poly-A); [10].
EX heart,,,adult; medium; Northern blot; mRNA (poly-A); [10].
EX heart,,,fetal; high; Northern blot; mRNA (poly-A); [10].
EX kidney (right and left),,,adult; none; Northern blot; mRNA (poly-A); [10].
EX kidney (right and left),,,fetal; high; Northern blot; mRNA (poly-A); [10].
EX liver,,,fetal; medium; Northern blot; mRNA (poly-A); [10].
EX lung (right and left),,,fetal; high; Northern blot; mRNA (poly-A); [10].
EX ovary (right and left),,,adult; medium; Northern blot; mRNA (poly-A); [10].
EX spleen,,,fetal; medium; Northern blot; mRNA (poly-A); [10].
EX thymus,,,adult; none; Northern blot; mRNA (poly-A); [10].
EX thymus,,,fetal; medium; Northern blot; mRNA (poly-A); [10].
EX tonsil,,,adult; medium; Northern blot; mRNA (poly-A); [10].
EX uterus,,,adult; medium; Northern blot; mRNA (poly-A); [10].
XX
FF in acute lymphoblastic leukemias, a t(1;
FF 19)(q23;
FF p13.3) translocation fuses the trans-activation domain encoded by the E2A gene with the homeobox of PBX1 [4] [1] [2];
FF the resulting chimeric protein (E2A-Pbx1) causes acute myeloid leukemia and induces enhanced proliferation as well as apoptosis probably by interfering with differentiation regulation by homeo domain factors and acting as a strong activator [3] [5] [7] [8] [9];
FF acts as cofactor of HOXB1 T01719 and cooperative transcriptional activator [11];
FF PKNOX2/Pbx-1a heterodimer (T01481/T05155) shows faster DNA-dissociation rate (binding site: R08497) than PKNOX1/Pbx-1a heterodimer (T01481/T04122) [16];
XX
IN T14354 hoxa9; mouse, Mus musculus.
IN T04122 PREP-1; human, Homo sapiens.
IN T05155 PREP-2; human, Homo sapiens.
XX
MX M00096 V$PBX1_01.
MX M00124 V$PBX1_02.
MX M01357 V$PBX1_04.
MX M07451 V$PBX1_10.
MX M02028 V$PBX1_Q3.
MX M00998 V$PBX_Q3.
MX M07304 V$PBX_Q5.
XX
BS R06396.
BS R06397.
BS R06398.
BS R06399.
BS R06400.
BS R06401.
BS R06402.
BS R06403.
BS R06404.
BS R06405.
BS R06406.
BS R06407.
BS R06408.
BS R06409.
BS R06410.
BS R06411.
BS R06818.
BS R06819.
BS R06820.
BS R06821.
BS R06822.
BS R06823.
BS R06824.
BS R06825.
BS R06826.
BS R06827.
BS R06828.
BS R06829.
BS R06830.
BS R06831.
BS R06832.
BS R06833.
BS R06834.
BS R06835.
BS R06836.
BS R06837.
BS R06838.
BS R06839.
BS R06840.
BS R06841.
BS R06842.
BS R06843.
BS R06844.
BS R06845.
BS R06846.
BS R06847.
BS R06848.
BS R06849.
BS R06850.
BS R06851.
BS R06852.
BS R06853.
BS R06854.
BS R06855.
BS R06856.
BS R06857.
BS R15380.
BS R14734.
BS R09696.
BS R09700.
BS R09701.
BS R14719.
BS R08497.
BS R09699.
BS R12755.
BS R04572.
BS R04724.
XX
DR TRANSPATH: MO000025703.
DR EMBL: M86546;
DR UniProtKB: P40424-1;
XX
RN [1]; RE0000161.
RX PUBMED: 1967982.
RA Nourse J., Mellentin J. D., Galili N., Wilkinson J., Stanbridge E., Smith S. D., Cleary M. L.
RT Chromosomal translocation t(1;19) results in synthesis of a homeobox fusion mRNA that codes for a potential chimeric transcription factor
RL Cell 60:535-545 (1990).
RN [2]; RE0000671.
RX PUBMED: 1672117.
RA Kamps M. P., Look A. T., Baltimore D.
RT The human t(1;19) translocation in pre-B ALL produces multiple nuclear E2A-Pbx1 fusion proteins with differing transforming potentials
RL Genes Dev. 5:358-368 (1991).
RN [3]; RE0003009.
RX PUBMED: 7910944.
RA Lu Q., Wright D. D., Kamps M. P.
RT Fusion with E2A converts the Pbx1 homeodomain protein into a constitutive transcriptional activator in human leukemias carrying the t(1;19) translocation
RL Mol. Cell. Biol. 14:3938-3948 (1994).
RN [4]; RE0004014.
RX PUBMED: 1967983.
RA Kamps M. P., Murre C., Sun X. H., Baltimore D.
RT A new homeobox gene contributes the DNA binding domain oft the t(1; 19) translocation protein in pre-B ALL
RL Cell 60:547-555 (1990).
RN [5]; RE0004018.
RX PUBMED: 8093327.
RA Kamps M. P., Baltimore D.
RT E2A-Pbx1, the t(1;19) translocation protein of human pre-B-cell acute lymphocytic leukemia causes acute myeloid leukemia in mice
RL Mol. Cell. Biol. 13:351-357 (1993).
RN [6]; RE0005177.
RX PUBMED: 7913464.
RA Kagawa N., Ogo A., Takahashi Y., Iwamatsu A., Waterman M. R.
RT A cAMP-regulatory sequence (CRS1) of CYP17 is a cellular target for the homeodomain protein Pbx1
RL J. Biol. Chem. 269:18716-18719 (1994).
RN [7]; RE0005178.
RX PUBMED: 7791786.
RA Lu Q., Knoepfler P. S., Scheele J., Wright D. D., Kamps M. P.
RT Both Pbx1 and E2A-Pbx1 bind the DNA motif ATCAATCAA cooperatively with the products of multiple murine Hox genes, some of which are themselves oncogenes.
RL Mol. Cell. Biol. 15:3786-3795 (1995).
RN [8]; RE0005179.
RX PUBMED: 7623795.
RA Phelan M. L., Rambaldi I., Featherstone M. S.
RT Cooperative interactions between HOX and PBX proteins mediated by a conserved peptide motif
RL Mol. Cell. Biol. 15:3989-3997 (1995).
RN [9]; RE0005180.
RX PUBMED: 8104101.
RA Dedera D. A., Waller E. K., LeBrun D. P., Sen-Majumdar A., Stevens M. E., Barsh G. S., Cleary M. L.
RT Chimeric homeobox gene E2A-PBX1 induces proliferation, apoptosis, and malignant lymphomas in transgenic mice
RL Cell 74:833-843 (1993).
RN [10]; RE0005181.
RX PUBMED: 1682799.
RA Monica K., Saltman D., Nourse J., Galili N., Cleary M. L.
RT PBX2 and PBX3, new homeobox genes with extensive homology to the human proto-oncogene PBX1
RL Mol. Cell. Biol. 11:6149-6157 (1991).
RN [11]; RE0005973.
RX PUBMED: 9218805.
RA Rocco di G., Mavilio F., Zappavigna V.
RT Functional dissection of a transcripitonally active, target-specific Hox-Pbx complex
RL EMBO J. 16:3644-3654 (1997).
RN [12]; RE0014544.
RX PUBMED: 9336443.
RA Burglin T. R.
RT Analysis of TALE superclass homeobox genes (MEIS, PBC, KNOX, Iroquois, TGIF) reveals a novel domain conserved between plants and animals
RL Nucleic Acids Res. 25:4173-4180 (1997).
RN [13]; RE0015488.
RX PUBMED: 9482739.
RA Berthelsen J., Zappavigna V., Mavilio F., Blasi F.
RT Prep1, a novel functional partner of Pbx proteins
RL EMBO J. 17:1423-1433 (1998).
RN [14]; RE0015495.
RX PUBMED: 9405651.
RA Knoepfler P. S., Calvo K. R., Chen H., Antonarakis S. E., Kamps M. P.
RT Meis1 and pKnox1 bind DNA cooperatively with Pbx1 utilizing an interaction surface disrupted in oncoprotein E2a-Pbx1
RL Proc. Natl. Acad. Sci. USA 94:14553-14558 (1997).
RN [15]; RE0015500.
RX PUBMED: 9482740.
RA Berthelsen J., Zappavigna V., Ferretti E., Mavilio F., Blasi F.
RT The novel homeoprotein Prep1 modulates Pbx-Hox protein cooperativity
RL EMBO J. 17:1434-1445 (1998).
RN [16]; RE0017883.
RX PUBMED: 11972344.
RA Fognani C., Kilstrup-Nielsen C., Berthelsen J., Ferretti E., Zappavigna V., Blasi F.
RT Characterization of PREP2, a paralog of PREP1, which defines a novel sub-family of the MEINOX TALE homeodomain transcription factors
RL Nucleic Acids Res. 30:2043-2051 (2002).
RN [17]; RE0024042.
RX PUBMED: 9234726.
RA Neuteboom S. T., Murre C.
RT Pbx raises the DNA binding specificity but not the selectivity of antennapedia Hox proteins.
RL Mol. Cell. Biol. 17:4696-4706 (1997).
RN [18]; RE0024570.
RX PUBMED: 8183558.
RA LeBrun D. P., Cleary M. L.
RT Fusion with E2A alters the transcriptional properties of the homeodomain protein PBX1 in t(1;19) leukemias.
RL Oncogene 9:1641-1647 (1994).
RN [19]; RE0065074.
RX PUBMED: 10082572.
RA Shen W. F., Rozenfeld S., Kwong A., Kom ves L. G., Lawrence H. J., Largman C.
RT HOXA9 forms triple complexes with PBX2 and MEIS1 in myeloid cells.
RL Mol. Cell. Biol. 19:3051-3061 (1999).
XX
//