TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T04282 XX ID T04282 XX DT 01.02.2001 (created); rio. DT 18.07.2008 (updated); tgo. CO Copyright (C), QIAGEN. XX FA Irx-2 XX SY iroquois-related homeobox factor 2; Irx2. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G004480 Irx2. XX CL C0006; homeo. XX SZ 474 AA; 49.5 kDa (cDNA) (calc.). XX SQ MSYPQGYLYQAPGSLALYSCPAYGASALAAPRSEELARSASGSAFSPYPGSAAFTAQAAT SQ GFGSPLQYSADAAAAAAAGFPSYVGSPYDTHTTGMTGAISYHPYGSAAYPYQLNDPAYRK SQ NATRDATATLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMT SQ WAPRNKSEDEDEDEGDASRSKEESSDKAQDGTETSAEDEGISLHVDSLTDHSCSAESDGE SQ KLPCRAGDALCESGSECKDKFEDLEDEEDEEDECERDLAPPKPVTSSPLTGVEAPLLSPA SQ PEAAPRGGSGGKTPLGSRTSPGAPPPASKPKLWSLAEIATSDLKQPSLGPGCGPPGLPAA SQ AAPASTGAPPGGSPYSASPLLGRHLYYTSPFYGNYTNYGNLNAALQGQGLLRYNTAASSP SQ GETLHAMPKAASDTGKAGSHSLESHYRPPGGGYEPKKDTSEGCAVVGAGVQTYL XX SC translated from EMBL #AF295369 XX FT 113 176 PS50071; HOMEOBOX_2. FT 115 180 SM00389; HOX_1. FT 116 175 PF00046; Homeobox domain. FT 325 342 SM00548; IRO. FT 329 340 IRO box [2]. XX SF TALE (three amino acid loop extension) homeo domain superclass [1]; SF homeo domain is identical to human IRX2a T02436 and Irx-5 T04283 of mouse [2]; SF Irx-1 T04281 and Irx-2 have similar expression patterns but Irx-2 is exclusively expressed in the follicles of wiskers [2]; XX EX atrioventricular bundle trunk,,,Theiler Stage 26; detectable; RNA-in situ hybridization (not further specified); RNA (undefined); [2]. EX interventricular septum,,,Theiler Stage 19; detectable; RNA-in situ hybridization (not further specified); RNA (undefined); [2]. EX interventricular septum,,,Theiler Stage 23; detectable; RNA-in situ hybridization (not further specified); RNA (undefined); [2]. EX interventricular septum,,,Theiler Stage 24; detectable; RNA-in situ hybridization (not further specified); RNA (undefined); [2]. EX interventricular septum,,,Theiler Stage 25; detectable; RNA-in situ hybridization (not further specified); RNA (undefined); [2]. EX interventricular septum,,,Theiler Stage 26; detectable; RNA-in situ hybridization (not further specified); RNA (undefined); [2]. EX lung,,,Theiler Stage 26; detectable; RNA-in situ hybridization (not further specified); RNA (undefined); [2]. EX trabeculae carneae,cardiac myocyte,,Theiler Stage 17; detectable; RNA-in situ hybridization (not further specified); RNA (undefined); [2]. XX FF role in specification of septum and components of the ventricular conduction system [2]; XX MX M01405 V$IRX2_01. XX DR TRANSPATH: MO000028146. DR EMBL: AF295369; DR UniProtKB: P81066; XX RN [1]; RE0014544. RX PUBMED: 9336443. RA Burglin T. R. RT Analysis of TALE superclass homeobox genes (MEIS, PBC, KNOX, Iroquois, TGIF) reveals a novel domain conserved between plants and animals RL Nucleic Acids Res. 25:4173-4180 (1997). RN [2]; RE0015698. RX PUBMED: 10926765. RA Christoffels V. M., Keijser A. G., Houweling A. C., Clout D. E., Moorman A. F. RT Patterning the embryonic heart: identification of five mouse Iroquois homeobox genes in the developing heart RL Dev. Biol. 224:263-274 (2000). XX //