TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T04372 XX ID T04372 XX DT 07.03.2001 (created); rio. CO Copyright (C), QIAGEN. XX FA Hand2 XX SY dHand; heart- and neural crest derivatives-expressed 2; Th2; Thing2. XX OS chick, Gallus gallus OC eukaryota; animalia; metazoa; chordata; vertebrata; aves; neornithes; neognathae; galliformes; phasianidae XX CL C0010; bHLH. XX SZ 216 AA; 24.4 kDa (cDNA) (calc.). XX SQ MSLVGGFPHHPVVHHEGYPLRRRRCRRRRRHPLRPRGEPLLHGWLISSHPEMSPPDYSMA SQ LSYSPEYANGAPGMDHSHYGGVPPGSGPPGLGGPRPVKRRGTANRKERRRTQSINSAFAE SQ LRECIPNVPADTKLSKIKTLRLATSYIAYLMDLLPKDDQNGEAEAFKAEIKKTDVKEEKR SQ KKELNEILKSTVSSSDKKTKGRTGWPQHVWALELKQ XX SC translated from EMBL #U40040 XX FT 98 151 PS50888; HLH. FT 99 151 PF00010; Helix-loop-helix DNA-binding domain. FT 104 156 SM00353; finulus. XX SF 96% amino acid identity to murine Hand2 T04370 [1]; XX CP (stage 8:) lateral plate mesoderm, precardiogenic mesoderm, (stage 9:) cardiac crescent, (stage 10:) cardiac tube, sinus venosus, (stage 14:) whole anterior-posterior lateral plate mesoderm, (stage 16-18:) gradient along anterior posterior axis of limb/wing buds, (stage 19-20:) posterior limb bud, (stage 15-20:) atria, left ventricle, bulbus cordis, truncus arteriosus, branchial arches, (stage 23-25:) proximal-anterior location of leg bud, (stage 26-27:) autopod, tarsus, metatarsus, carpus, metacarpus, (stage 28:) interdigits, (stage 30:) lateral borders of developing digits [2] [1]. XX FF Hand2 together with Hand1 T04371 may play redundant roles in regulation of heart development especially cardiac looping [1]; FF expression is dependent on AER (apical ectodermal ridge) signalling like Fgf2 [2]; FF overexpression can produce preaxial polydactyly [2]; FF activates members of the shh (sonic hedgehog) pathway (Gli, Patched) [2]; FF role in anterior-posterior patterning of the limb bud [2]; XX MX M01034 V$EBOX_Q6_01. XX DR TRANSPATH: MO000028229. DR EMBL: U40040; DR UniProtKB: Q90690; XX RN [1]; RE0006279. RX PUBMED: 8533092. RA Srivastava D., Cserjesi P., Olson E. N. RT A subclass of bHLH proteins required for cardiac morphogenesis RL Science 270:1995-1999 (1995). RN [2]; RE0015976. RX PUBMED: 10769237. RA Fernandez-Teran M., Piedra M. E., Kathiriya I. S., Srivastava D., Rodriguez-Rey J. C., Ros M. A. RT Role of dHAND in the anterior-posterior polarization of the limb bud: implications for the Sonic hedgehog pathway RL Development 127:2133-2142 (2000). XX //