TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T04757 XX ID T04757 XX DT 11.09.2001 (created); rhe/rge. DT 11.08.2010 (updated); smt. CO Copyright (C), QIAGEN. XX FA TGA2.1 XX OS tobacco, Nicotiana tabacum OC eukaryota; viridiplantae; embryobionta; magnoliophyta; magnoliopsida; asteridae; solanes; solanaceae XX GE G002687 TGA2.1. XX CL C0008; bZIP. XX SZ 456 AA; 50.1 kDa (calc.). XX SQ MASKIGTAGNRSGTTGMPSFISQIPVSNPMGTEANNTNTSRMSDFGVLEQYLGFRIGDGA SQ NVNRSPLFNSTSATNPAVGFEVSGTINRTLAPSNTSLPTATPRSQTMLLQSNLVSASGTH SQ HENWGESNMADSGSRTDTSTDMDGDDKNQLIEAGQSSDKSKEKVLDQKTLRRLAQNREAA SQ RKSRLRKKAYVQQLENSRLKLSQLEQDLQRARQQGKYISNIADQSNGVGANGPLAFDAEY SQ SRWLEEHNKHINELRTAVNAHASDPELRSIVNNVTAHFDEVFRVKGNAAKADVFHVLSGM SQ WKTPAERCFMWIGGFRPSELLKLLVNQLEPLTEQQLAGIYNLQQSSHQAEDALSQGMEAL SQ QQSLAETLANGSPAPEGSSGDVANYMGQMAMAMGKLGTLEGFLRQADNLRQQTLQQMHRV SQ LTTRQSARALLAINEYFSRLRALSSLWLARPREQLV XX SC translated from EMBL #U90214 XX FT 76 439 PF00478; IMP dehydrogenase / GMP reductase domain. FT 162 227 PF00170; bZIP transcription factor. FT 164 227 SM00338; brlzneu. FT 166 210 PS50217; BZIP. XX SF the N-terminal domain of TGA2.1 led to reduced in vitro as-1-binding activity and almost completely abolished binding to one half site of this bifunctional element [1]; SF When being part of a heterodimer with TGA2.2, TGA2.1 was efficiently recruited to a single half site, though double occupancy of the element was still preferred [1]; XX CP root, leaf [1]. XX FF In tga2.1 mutant plant (dsRNAi) 75-80% stamens developed into sterile petal-like structure [2]; FF transcriptional activator [1]; FF interacted with ankyrin repeat protein NPR1, a central activator of the plant defense response [1]; XX IN T04760 NPR1; thale cress, Arabidopsis thaliana. IN T04758 TGA2.2; tobacco, Nicotiana tabacum. XX BS R00009. XX DR EMBL: U90214; DR UniProtKB: O24160; XX RN [1]; RE0016869. RX PUBMED: 10809449. RA Niggeweg R., Thurow C., Weigel R., Pfitzner U., Gatz C. RT Tobacco TGA factors differ with respect to interaction with NPR1, activation potential and DNA-binding properties RL Plant Mol. Biol. 42:775-788 (2000). RN [2]; RE0047517. RX PUBMED: 16167899. RA Thurow C., Schiermeyer A., Krawczyk S., Butterbrodt T., Nickolov K., Gatz C. RT Tobacco bZIP transcription factor TGA2.2 and related factor TGA2.1 have distinct roles in plant defense responses and plant development. RL Plant J. 44:100-113 (2005). XX //