TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T04758 XX ID T04758 XX DT 11.09.2001 (created); rhe/rge. DT 11.08.2010 (updated); smt. CO Copyright (C), QIAGEN. XX FA TGA2.2 XX OS tobacco, Nicotiana tabacum OC eukaryota; viridiplantae; embryobionta; magnoliophyta; magnoliopsida; asteridae; solanes; solanaceae XX GE G002688 TGA2.2. XX CL C0008; bZIP. XX SZ 325 AA; 36.3 kDa (calc.). XX SQ MADISPSTSTDADTEDKNRFLNSQQLGAVASDGSDRTRDQKTLRRLAQNREAARKSRLRK SQ KAYVQQLESSRMKLTQLEQELQRARQQGIFISGSGDQSQSMSGNGALAFDVEYARWLEEQ SQ NRRINELRGAVNSHAGDGELRIIVDGILAHYDDIFRIKGDAAKSDVFHILSGMWKTPAER SQ CFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQQSLAET SQ LAGSLGPSSSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILTTRQSAR SQ ALLAISDYFSRLRALSSLWLARPRE XX SC translated from EMBL #AF031487 XX FT 37 90 PF00170; bZIP transcription factor. FT 37 100 SM00338; brlzneu. FT 39 83 PS50217; BZIP. FT 61 309 PF00478; IMP dehydrogenase / GMP reductase domain. XX SF dominant factor in ASF-1 T04851 and SARP T04853 complex [2]; XX CP root, leaf [1]. XX FF As indicated by the tga2.2 mutant plant (dsRNAi) analysis it acts as activator for SA-inducible gene expression from as-1 element, and expression of Nt103 and PR-1a, in which role of the TGA2.1 is dispensable [3]; FF TGA2.2 functioned not as transcriptional activator [1]; FF interacted with ankyrin repeat protein NPR1, a central activator of the plant defense response [1]; FF TGA2.2 is maybe a component of the enhanceosome assembling on these target promoters, both under elevated SA and 2,4D concentrations: Nt103 (glutathione S-transferase), IEGT (glucosyltransferase), ParA (similiar to glutathione S-transferase), PR-1a G001613 [2]; XX IN T04760 NPR1; thale cress, Arabidopsis thaliana. IN T05722 TGA10; tobacco, Nicotiana tabacum. IN T00829 TGA1a; tobacco, Nicotiana tabacum. IN T04757 TGA2.1; tobacco, Nicotiana tabacum. IN T04758 TGA2.2; tobacco, Nicotiana tabacum. XX BS R00009. XX DR EMBL: AF031487; DR UniProtKB: Q9SQK1; Q9SQK1_TOBAC. XX RN [1]; RE0016869. RX PUBMED: 10809449. RA Niggeweg R., Thurow C., Weigel R., Pfitzner U., Gatz C. RT Tobacco TGA factors differ with respect to interaction with NPR1, activation potential and DNA-binding properties RL Plant Mol. Biol. 42:775-788 (2000). RN [2]; RE0017059. RX PUBMED: 10751419. RA Niggeweg R., Thurow C., Kegler C., Gatz C. RT Tobacco transcription factor TGA2.2 is the main component of as-1-binding factor ASF-1 and is involved in salicylic acid- and auxin-inducible expression of as-1-containing target promoters RL J. Biol. Chem. 275:19897-19905 (2000). RN [3]; RE0047517. RX PUBMED: 16167899. RA Thurow C., Schiermeyer A., Krawczyk S., Butterbrodt T., Nickolov K., Gatz C. RT Tobacco bZIP transcription factor TGA2.2 and related factor TGA2.1 have distinct roles in plant defense responses and plant development. RL Plant J. 44:100-113 (2005). XX //