TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T05041 XX ID T05041 XX DT 27.02.2002 (created); mas. DT 27.01.2016 (updated); mkl. CO Copyright (C), QIAGEN. XX FA COL-1 XX SY COL; COL isoform 1; COL1; Collier; KN; knot. XX OS fruit fly, Drosophila melanogaster OC eukaryota; animalia; metazoa; arthropoda; insecta; diptera; drosophiloidea; drosophilidae XX GE G003030 kn. XX HO COE1 (mouse), Olf-1 (rat). XX CL C0011; HLH. XX SZ 575 AA; 62.5 kDa (calc.). XX SQ MEWGRKLYPSAVSGPRSAGGLMFGLPPTAAVDMNQPRGPMTSLKEEPLGSRWAMQPVVDQ SQ SNLGIGRAHFEKQPPSNLRKSNFFHFVIALYDRAGQPIEIERTAFIGFIEKDSESDATKT SQ NNGIQYRLQLLYANGARQEQDIFVRLIDSVTKQAIIYEGQDKNPEMCRVLLTHEVMCSRC SQ CDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVISTQVAVDGP SQ LLAISDNMFVHNNSKHGRRAKRLDTTEGTGNTSLSISGHPLAPDSTYDGLYPPLPVATPC SQ IKAISPSEGWTTGGATVIIVGDNFFDGLQVVFGTMLVWSELITSHAIRVQTPPSDIPGVV SQ EVTLSYKSKQFCKGSPGRFVYVSALNEPTIDYGFQRLQKLIPRHPGDPEKLQKEIILKRA SQ ADLVEALYSMPRSPDGSTGFNSYAGQLAVSVQDGSGQWTEDDYQRAQSSSVSPRGGYCSS SQ ASTPHSSGGSYGATAASAAVAATANGYAPAPNMGTLSSSPGSVFNSTSMSAVSSTWHQAF SQ VQHHHAATAHPHHHYPHPHQPWHNPAVSAATAAAV XX SC translated from EMBL #X97803 XX FT 59 288 DNA-binding domain [2]. FT 289 429 dimerization domain [2]. FT 298 382 SM00429; iptmega2. FT 299 382 PF01833; IPT/TIG domain. FT 413 431 type-2 HLH-related helix [1]. XX SF existence of two isoforms COL1 T05041 and COL2 T05055 due to alternative splicing (3.9 and 3.4 kb) [3]; SF absence of the first type-2 helix of the HLH-related motif which is found in mouse homologs T01112, T05006 [1]; SF DNA-binding domain shows 85 % and 86 % amino acid identity to that of mouse homologs T05041 and T01112 [1] [3]; XX CP (embryo:) detectable from 3 h AEL onwards, peak between 8 and 16 h AEL [3]; in stage 13 and 14 embryos expressed in a segmentally reiterated pattern in the ventral nerve cord and peripheral nervous system [3]; expressed in posterior cells of intercalary segment and anterior cells of mandibular segment (parasegment 0) [2] [3]; expressed during early gastrulation in mitotic domain 2 cells which enter mitosis synchronously [3]; (larvae, pupa:) low levels in L1, higher levels in L3, pupa [3] [2] [3]. XX FF required for normal embryonic head morphogenesis (second-level regulator in head patterning): reduction of its activity results in specific lack of head structures [2] [3]; FF expression controlled by gap genes of the head [3]; FF required for intercalary-segment expression both of the segment polarity genes hedgehog, engrailed, and wingless, and of the segment identity genes cap and collar [2]; FF its activation is controlled by the combined activities of the head-gap genes buttonhead and spiracles and the pair-rule gene even skipped [2]; FF it therefore integrates inputs from both the head and trunk segmentation systems, which were previously considered as being essentially independent [2]; XX DR TRANSPATH: MO000028790. DR EMBL: X97803; DR UniProtKB: P56721; DR FLYBASE: FBgn0001319. XX RN [1]; RE0017446. RX PUBMED: 9389446. RA Garel S., Marin F., Mattei M. G., Vesque C., Vincent A., Charnay P. RT Family of Ebf/Olf-1-related genes potentially involved in neuronal differentiation and regional specification in the central nervous system. RL Dev. Dyn. 210:191-205 (1997). RN [2]; RE0017574. RX PUBMED: 10477305. RA Crozatier M., Valle D., Dubois L., Ibnsouda S., Vincent A. RT Head versus trunk patterning in the Drosophila embryo; collier requirement for formation of the intercalary segment. RL Development 126:4385-4394 (1999). RN [3]; RE0017575. RX PUBMED: 8793297. RA Crozatier M., Valle D., Dubois L., Ibnsouda S., Vincent A. RT Collier, a novel regulator of Drosophila head development, is expressed in a single mitotic domain. RL Curr. Biol. 6:707-718 (1996). XX //