
AC T01112
XX
ID T01112
XX
DT 15.03.1994 (created); ewi.
DT 14.05.2009 (updated); pum.
CO Copyright (C), QIAGEN.
XX
FA COE1-long
XX
SY COE1; early B cell factor; Early B-cell Factor; Ebf; Ebf1; O/E-1; OE-1; Olf-1; Olf-1/EBF-like; Olf1.
XX
OS mouse, Mus musculus
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae
XX
GE G003029 Ebf1.
XX
HO collier (Drosophila).
XX
CL C0020; Rel; 6.1.5.0.1.1.
XX
SZ 591 AA; 64.5 kDa (cDNA) (calc.), 70-85 kDa (SDS) [1]
XX
SQ MFGIQESIQRSGSSMKEEPLGSGMNAVRTWMQGAGVLDANTAAQSGVGLARAHFEKQPPS
SQ NLRKSNFFHFVLALYDRQGQPVEIERTAFVGFVEKEKEANSEKTNNGIHYRLQLLYSNGI
SQ RTEQDFYVRLIDSMTKQAIVYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDP
SQ VIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVVSTTVNVDGHVLAVSDNMFVHNNSKH
SQ GRRARRLDPSEGTPSYLEHATPCIKAISPSEGWTTGGATVIIIGDNFFDGLQVIFGTMLV
SQ WSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGTPGRFIYTALNEPTIDYGFQRLQ
SQ KVIPRHPGDPERLPKEVILKRAADLVEALYGMPHNNQEIILKRAADIAEALYSVPRNHNQ
SQ LPALANTSVHAGMMGVNSFSGQLAVNVSEASQATNQGFTRNSSSVSPHGYVPSTTPQQTN
SQ YNSVTTSMNGYGSAAMSNLGGSPTFLNGSAANSPYAIVPSSPTMASSTSLPSNCSSSSGI
SQ FSFSPANMVSAVKQKSAFAPVVRPQTSPPPTCTSTNGNSLQAISGMIVPPM
XX
SC translated from EMBL #L12147
XX
FT 137 476
PF00478; IMP dehydrogenase / GMP reductase domain.
FT 261 345
SM00429; iptmega2.
FT 262 345
PF01833; IPT/TIG domain.
FT 367 429
dimerization domain [9].
FT 375 393
type-2 HLH-related helix [9].
FT 397 415
type-2 HLH-related helix [9].
FT 429 591
transcription activation domain 2 [6].
XX
SF splice variant of Olf-1 [3];
SF DNA-binding depends on zinc coordination [6];
SF the DBD also mediates dimerization at optimally positioned sites and activates transcription [6];
SF the putative HLH domain represents a second dimerization motif [6];
SF the C-terminus comprises a second trans-activating domain [6];
SF DNA-binding domain shows 85 % amino acid identity to that of Drosophila homolog T05041 [9];
XX
CN non-lymphoid cell lines [4].
EX Purkinje cell layer of cerebellar cortex,Purkinje's cell,,adult; detectable; RNA-in situ hybridization (not further specified); RNA (undefined); [7].
EX adipose tissue,,,adult; very high; immunohistochemistry / immunocytochemistry; protein; [4].
EX alar plate of spinal cord,interneuron,,Theiler Stage 16; detectable; RNA-in situ hybridization (not further specified); RNA (undefined); [9].
EX basal mantle layer of rhombencephalon,,,Theiler Stage 19; detectable; RNA-in situ hybridization (not further specified); RNA (undefined); [9].
EX brain,,,adult; low; immunohistochemistry / immunocytochemistry; protein; [4].
EX brain,,,adult; none; RNAse protection assay; total RNA; [7].
EX cerebellum,,,Theiler Stage 22; detectable; RNA-in situ hybridization (not further specified); RNA (undefined); [9].
EX cerebellum,,,Theiler Stage 22; high; RNA-in situ hybridization (not further specified); RNA (undefined); [7].
EX cerebellum,,,adult; high; RNAse protection assay; total RNA; [7].
EX cerebral cortex,,,Theiler Stage 21; low; RNA-in situ hybridization (not further specified); RNA (undefined); [9].
EX dorsal root ganglion,,,Theiler Stage 22; detectable; RNA-in situ hybridization (not further specified); RNA (undefined); [7].
EX dorsal root ganglion,,,Theiler Stage 22; high; RNA-in situ hybridization (not further specified); RNA (undefined); [7].
EX epithalamus,,,Theiler Stage 22; low; RNA-in situ hybridization (not further specified); RNA (undefined); [7].
EX eye and related structures (right and left),,,adult; very low; RNAse protection assay; total RNA; [7].
EX facial nuclei,,,Theiler Stage 22; detectable; RNA-in situ hybridization (not further specified); RNA (undefined); [9].
EX glossopharyngeal ganglion [IX],,,Theiler Stage 22; high; RNA-in situ hybridization (not further specified); RNA (undefined); [7].
EX granular layer of cerebellar cortex,granule cell,,adult; none; RNA-in situ hybridization (not further specified); RNA (undefined); [7].
EX heart,,,adult; low; immunohistochemistry / immunocytochemistry; protein; [4].
EX heart,,,adult; medium; RNAse protection assay; total RNA; [7].
EX hypothalamus,,,Theiler Stage 22; none; RNA-in situ hybridization (not further specified); RNA (undefined); [7].
EX intermediate column of lateral ventricle,,,Theiler Stage 22; none; RNA-in situ hybridization (not further specified); RNA (undefined); [7].
EX internal ear,,,Theiler Stage 22; detectable; RNA-in situ hybridization (not further specified); RNA (undefined); [7].
EX kidney (right and left),,,adult; low; immunohistochemistry / immunocytochemistry; protein; [4].
EX kidney (right and left),,,adult; medium; RNAse protection assay; total RNA; [7].
EX liver,,,adult; none; RNAse protection assay; total RNA; [7].
EX lung,,,adult; medium; RNAse protection assay; total RNA; [7].
EX lung,,,adult; very low; immunohistochemistry / immunocytochemistry; protein; [4].
EX lymph node,,,adult; high; immunohistochemistry / immunocytochemistry; protein; [4].
EX mammillary area,,,Theiler Stage 21; detectable; RNA-in situ hybridization (not further specified); RNA (undefined); [9].
EX mantle layer of alar plate of spinal cord,,,Theiler Stage 18; detectable; RNA-in situ hybridization (not further specified); RNA (undefined); [9].
EX mantle layer of alar plate of spinal cord,,,Theiler Stage 19; detectable; RNA-in situ hybridization (not further specified); RNA (undefined); [9].
EX medial ventricular eminence of diencephalon,,,Theiler Stage 21; detectable; RNA-in situ hybridization (not further specified); RNA (undefined); [9].
EX mesencephalon,,,Theiler Stage 21; detectable; RNA-in situ hybridization (not further specified); RNA (undefined); [9].
EX mesencephalon,,,Theiler Stage 22; low; RNA-in situ hybridization (not further specified); RNA (undefined); [7].
EX molecular layer of cerebellar cortex,,,adult; none; RNA-in situ hybridization (not further specified); RNA (undefined); [7].
EX muscles,,,adult; very low; immunohistochemistry / immunocytochemistry; protein; [4].
EX neural tube,,,Theiler Stage 19; detectable; RNA-in situ hybridization (not further specified); RNA (undefined); [9].
EX olfactory epithelium,,,Theiler Stage 22; high; RNA-in situ hybridization (not further specified); RNA (undefined); [7].
EX olfactory epithelium,,,Theiler Stage 22; very high; RNA-in situ hybridization (not further specified); RNA (undefined); [7].
EX olfactory epithelium,,,adult; very high; RNAse protection assay; total RNA; [7].
EX olfactory epithelium,basal cell,,adult; none; RNA-in situ hybridization (not further specified); RNA (undefined); [7].
EX olfactory epithelium,olfactory cell,,adult; detectable; RNA-in situ hybridization (not further specified); RNA (undefined); [7].
EX olfactory epithelium,sustentacular cell,,adult; none; RNA-in situ hybridization (not further specified); RNA (undefined); [7].
EX ovary,,,adult; very low; immunohistochemistry / immunocytochemistry; protein; [4].
EX retina,postmitotic cell,,Theiler Stage 22; medium; RNA-in situ hybridization (not further specified); RNA (undefined); [7].
EX rhombomere 02,,,Theiler Stage 15; detectable; RNA-in situ hybridization (not further specified); RNA (undefined); [9].
EX rhombomere 04,,,Theiler Stage 15; detectable; RNA-in situ hybridization (not further specified); RNA (undefined); [9].
EX salivary gland,,,adult; very low; immunohistochemistry / immunocytochemistry; protein; [4].
EX spinal cord,,,Theiler Stage 22; detectable; RNA-in situ hybridization (not further specified); RNA (undefined); [7].
EX spinal cord,,,Theiler Stage 22; high; RNA-in situ hybridization (not further specified); RNA (undefined); [7].
EX spinal cord,motor neuron,,Theiler Stage 16; detectable; RNA-in situ hybridization (not further specified); RNA (undefined); [9].
EX spleen,,,adult; very high; RNAse protection assay; total RNA; [7].
EX spleen,,,adult; very high; immunohistochemistry / immunocytochemistry; protein; [4].
EX subthalamus,,,Theiler Stage 21; none; RNA-in situ hybridization (not further specified); RNA (undefined); [9].
EX sulcus limitans,,,Theiler Stage 21; detectable; RNA-in situ hybridization (not further specified); RNA (undefined); [9].
EX superficial layer of posterior horn,,,Theiler Stage 22; high; RNA-in situ hybridization (not further specified); RNA (undefined); [7].
EX superior olive,,,Theiler Stage 22; detectable; RNA-in situ hybridization (not further specified); RNA (undefined); [9].
EX testis (right and left),,,adult; low; RNAse protection assay; total RNA; [7].
EX testis (right and left),,,adult; very low; immunohistochemistry / immunocytochemistry; protein; [4].
EX thalamus,,,Theiler Stage 21; detectable; RNA-in situ hybridization (not further specified); RNA (undefined); [9].
EX thalamus,,,Theiler Stage 22; low; RNA-in situ hybridization (not further specified); RNA (undefined); [7].
EX thymus,,,adult; low; RNAse protection assay; total RNA; [7].
EX thymus,,,adult; very low; immunohistochemistry / immunocytochemistry; protein; [4].
EX trigeminal ganglion [V],,,Theiler Stage 22; high; RNA-in situ hybridization (not further specified); RNA (undefined); [7].
EX vomeronasal organ,,,Theiler Stage 22; high; RNA-in situ hybridization (not further specified); RNA (undefined); [7].
XX
FF activator [7] [10] [11] [12] [13] [14];
FF DNA-binding activity present only in early B cell stages, not in late stage B cells, T cells, or non-lymphoid cells;
FF required for B-cell differentiation after lineage commitment and before Ig gene rearrangement stage [5];
FF important regulator of B-cell development [11] [12] [13] [14];
FF can act in cooperation with BSAP (Pax-5) [11];
FF can act in cooperation with E47 [10] [13] [14];
XX
IN T15118 CBP; Mammalia.
IN T18378 CBP; human, Homo sapiens.
IN T01112 COE1-long; mouse, Mus musculus.
IN T05006 COE2; mouse, Mus musculus.
IN T05008 COE3; mouse, Mus musculus.
IN T02815 OAZ; rat, Rattus norvegicus.
XX
MX M01871 V$COE1_Q6.
MX M07351 V$COE1_Q6_01.
MX M00977 V$EBF_Q6.
MX M00261 V$OLF1_01.
XX
BS R13338.
BS R03699.
BS R13339.
BS R13340.
BS R13341.
BS R13331.
BS R13345.
BS R13346.
BS R03700.
BS R03620.
BS R03622.
BS R03618.
BS R03609.
BS R03611.
XX
DR TRANSPATH: MO000025409.
DR TRANSCOMPEL: C00374.
DR TRANSCOMPEL: C00376.
DR TRANSCOMPEL: C00377.
DR EMBL: L12147;
DR UniProtKB: Q07802-1;
XX
RN [1]; RE0000537.
RX PUBMED: 1915300.
RA Hagman J., Travis A., Grosschedl R.
RT A novel lineage-specific nuclear factor regulates mb-1 gene transcription at the early stages of B cell differentiation
RL EMBO J. 10:3409-3417 (1991).
RN [2]; RE0001692.
RX PUBMED: 8474458.
RA Kudrycki K., Stein-Izsak C., Behn C., Grillo M., Akeson R., Margolis F. L.
RT Olf-1-binding site: characterization of an olfactory neuron-specific promoter motif
RL Mol. Cell. Biol. 13:3002-3014 (1993).
RN [3]; RE0001906.
RX PUBMED: 8321284.
RA Wang M. M., Reed R. R.
RT Molecular cloning of the olfactory neuronal transcription factor Olf-1 by genetic selection in yeast
RL Nature 364:121-126 (1993).
RN [4]; RE0003600.
RX PUBMED: 8491377.
RA Hagman J., Belanger C., Travis A., Turck C. W., Grosschedl R.
RT Cloning and functional characterization of early B-cell factor, a regulator of lymphocyte-specific gene expression
RL Genes Dev. 7:760-773 (1993).
RN [5]; RE0003601.
RX PUBMED: 7542362.
RA Lin H., Grosschedl R.
RT Failure of B-cell differentiation in mice lacking the transcription factor EBF
RL Nature 376:263-267 (1995).
RN [6]; RE0003831.
RX PUBMED: 7796816.
RA Hagman J., Gutch M. J., Lin H., Grosschedl R.
RT EBF contains a novel zinc coordination motif and multiple dimerization and transcriptional activation domains
RL EMBO J. 14:2907-2916 (1995).
RN [7]; RE0016789.
RX PUBMED: 9151732.
RA Wang S. S., Tsai R. Y., Reed R. R.
RT The characterization of the Olf-1/EBF-like HLH transcription factor family: implications in olfactory gene regulation and neuronal development
RL J. Neurosci. 17:4149-4158 (1997).
RN [8]; RE0016790.
RX PUBMED: 9151733.
RA Tsai R. Y., Reed R. R.
RT Cloning and functional characterization of Roaz, a zinc finger protein that interacts with O/E-1 to regulate gene expression: implications for olfactory neuronal development.
RL J. Neurosci. 17:4159-4169 (1997).
RN [9]; RE0017446.
RX PUBMED: 9389446.
RA Garel S., Marin F., Mattei M. G., Vesque C., Vincent A., Charnay P.
RT Family of Ebf/Olf-1-related genes potentially involved in neuronal differentiation and regional specification in the central nervous system.
RL Dev. Dyn. 210:191-205 (1997).
RN [10]; RE0022502.
RX PUBMED: 12077253.
RA Smith E. M., Gisler R., Sigvardsson M.
RT Cloning and characterization of a promoter flanking the early B cell factor (EBF) gene indicates roles for E-proteins and autoregulation in the control of EBF expression.
RL J. Immunol. 169:261-270 (2002).
RN [11]; RE0022512.
RX PUBMED: 10553071.
RA Akerblad P., Sigvardsson M.
RT Early B cell factor is an activator of the B lymphoid kinase promoter in early B cell development.
RL J. Immunol. 163:5453-5461 (1999).
RN [12]; RE0022513.
RX PUBMED: 9858563.
RA Akerblad P., Rosberg M., Leanderson T., Sigvardsson M.
RT The B29 (immunoglobulin beta-chain) gene is a genetic target for early B-cell factor.
RL Mol. Cell. Biol. 19:392-401 (1999).
RN [13]; RE0022514.
RX PUBMED: 10435576.
RA O Riordan M., Grosschedl R.
RT Coordinate regulation of B cell differentiation by the transcription factors EBF and E2A.
RL Immunity 11:21-31 (1999).
RN [14]; RE0022515.
RX PUBMED: 10779354.
RA Sigvardsson M.
RT Overlapping expression of early B-cell factor and basic helix-loop-helix proteins as a mechanism to dictate B-lineage-specific activity of the lambda5 promoter.
RL Mol. Cell. Biol. 20:3640-3654 (2000).
RN [15]; RE0048844.
RX PUBMED: 12748286.
RA Zhao F., McCarrick-Walmsley R., Akerblad P., Sigvardsson M., Kadesch T.
RT Inhibition of p300/CBP by early B-cell factor.
RL Mol. Cell. Biol. 23:3837-3846 (2003).
XX
//