TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T05055 XX ID T05055 XX DT 01.03.2002 (created); mas. CO Copyright (C), QIAGEN. XX FA COL-2 XX SY COL; COL isoform 2; COL2; Collier; KN; knot. XX OS fruit fly, Drosophila melanogaster OC eukaryota; animalia; metazoa; arthropoda; insecta; diptera; drosophiloidea; drosophilidae XX GE G003030 kn. XX HO COE1 (mouse), Olf-1 (rat). XX CL C0011; HLH. XX SZ 557 AA; 60.5 kDa (calc.). XX SQ MEWGRKLYPSAVSGPRSAGGLMFGLPPTAAVDMNQPRGPMTSLKEEPLGSRWAMQPVVDQ SQ SNLGIGRAHFEKQPPSNLRKSNFFHFVIALYDRAGQPIEIERTAFIGFIEKDSESDATKT SQ NNGIQYRLQLLYANGARQEQDIFVRLIDSVTKQAIIYEGQDKNPEMCRVLLTHEVMCSRC SQ CDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVISTQVAVDGP SQ LLAISDNMFVHNNSKHGRRAKRLDTTEGTGNTSLSISGHPLAPDSTYDGLYPPLPVATPC SQ IKAISPSEGWTTGGATVIIVGDNFFDGLQVVFGTMLVWSELITSHAIRVQTPPSDIPGVV SQ EVTLSYKSKQFCKGSPGRFVYVSALNEPTIDYGFQRLQKLIPRHPGDPEKLQKEIILKRA SQ ADLVEALYSMPRSPDGSTGFNSYAGQLAVSVQDGSGQWTEDDYQRAQSSSVSPRGGYCSS SQ ASTPHSSGGSYGATAASAAVAATANGYAPAPNMGTLSSSPGSVFNSTSRVSSLSFNPFAL SQ PTCNTQGYSTQLVTSTK XX SC translated from EMBL #X97803 and modified according to [3] XX FT 59 288 DNA-binding domain [2]. FT 289 429 dimerization domain [2]. FT 298 382 SM00429; iptmega2. FT 299 382 PF01833; IPT/TIG domain. FT 417 431 type-2 HLH-related helix [1]. XX SF existence of two isoforms COL1 T05041 and COL2 T05055 due to alternative splicing (3.9 and 3.4 kb) [3]; SF absence of one of the type-2 helices of the HLH-related motifs which is found in mouse homologs T01112, T05006 [1]; SF DNA-binding domain shows 85 % and 86 % amino acid identity to that of mouse homologs T05041 and T01112 [1] [3]; XX CP (embryo:) peak at 8 h AEL [3]; (larvae, pupa:) high levels in L1, lower levels in L3, pupa [3] [3]. XX FF required for normal embryonic head morphogenesis (second-level regulator in head patterning): reduction of its activity results in specific lack of head structures [3]; FF expression controlled by gap genes of the head [3]; XX DR TRANSPATH: MO000028798. DR EMBL: X97803; DR UniProtKB: P56721; DR FLYBASE: FBgn0001319. XX RN [1]; RE0017446. RX PUBMED: 9389446. RA Garel S., Marin F., Mattei M. G., Vesque C., Vincent A., Charnay P. RT Family of Ebf/Olf-1-related genes potentially involved in neuronal differentiation and regional specification in the central nervous system. RL Dev. Dyn. 210:191-205 (1997). RN [2]; RE0017574. RX PUBMED: 10477305. RA Crozatier M., Valle D., Dubois L., Ibnsouda S., Vincent A. RT Head versus trunk patterning in the Drosophila embryo; collier requirement for formation of the intercalary segment. RL Development 126:4385-4394 (1999). RN [3]; RE0017575. RX PUBMED: 8793297. RA Crozatier M., Valle D., Dubois L., Ibnsouda S., Vincent A. RT Collier, a novel regulator of Drosophila head development, is expressed in a single mitotic domain. RL Curr. Biol. 6:707-718 (1996). XX //