
AC T05129
XX
ID T05129
XX
DT 24.05.2002 (created); mas.
CO Copyright (C), QIAGEN.
XX
FA ZER6 p52
XX
SY ZER 6; ZER-6; ZER6; Zinc Finger DNA Binding Protein p52; Zinc Finger Estrogen Receptor Interaction Clone 6.
XX
OS human, Homo sapiens
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates
XX
GE G004144 ZNF398; HGNC: ZNF398.
XX
CL C0001; CH; 2.3.3.38.2.2.
XX
SZ 471 AA; 52.0 kDa (cDNA) (calc.).
XX
SQ MKGNYESLISMDYAINQPDVLSQIQPEGEHNTEDQAGPEESEIPTDPSEEPGISTSDILS
SQ WIKQEEEPQVGAPPESKESDVYKSTYADEELVIKAEGLARSSLCPEVPVPFSSPPAAAKD
SQ AFSDVAFKSQQSTSMTPFGRPATDLPEASEGQVTFTQLGSYPLPPPVGEQVFSCHHCGKN
SQ LSQDMLLTHQCSHATEHPLPCAQCPKHFTPQADLSSTSQDHASETPPTCPHCARTFTHPS
SQ RLTYHLRVHNSTERPFPCPDCPKRFADQARLTSHRRAHASERPFRCAQCGRSFSLKISLL
SQ LHQRGHAQERPFSCPQCGIDFNGHSALIRHQMIHTGERPYPCTDCSKSFMRKEHLLNHRR
SQ LHTGERPFSCPHCGKSFIRKHHLMKHQRIHTGERPYPCSYCGRSFRYKQTLKDHLRSGHN
SQ GGCGGDSDPSGQPPNPPGPLITGLETSGLGVNTEGLETNQWYGEGSGGGVL
XX
SC translated from EMBL #AY049743
XX
FT 172 193
SM00355; c2h2final6.
FT 199 226
PS50157; ZINC_FINGER_C2H2_2.
FT 227 249
PF00096; zf-C2H2.
FT 227 249
SM00355; c2h2final6.
FT 227 254
PS50157; ZINC_FINGER_C2H2_2.
FT 256 278
zinc finger, C2H2-type (F/Y-X2-C-X2-5-C-X3-F/Y-X5-L-X2-H-X3-5-H) [1].
FT 256 278
PF00096; zf-C2H2.
FT 256 278
SM00355; c2h2final6.
FT 256 283
PS50157; ZINC_FINGER_C2H2_2.
FT 284 306
zinc finger, C2H2-type (F/Y-X2-C-X2-5-C-X3-F/Y-X5-L-X2-H-X3-5-H) [1].
FT 284 306
PF00096; zf-C2H2.
FT 284 306
SM00355; c2h2final6.
FT 284 311
PS50157; ZINC_FINGER_C2H2_2.
FT 312 334
zinc finger, C2H2-type (F/Y-X2-C-X2-5-C-X3-F/Y-X5-L-X2-H-X3-5-H) [1].
FT 312 334
PF00096; zf-C2H2.
FT 312 334
SM00355; c2h2final6.
FT 312 339
PS50157; ZINC_FINGER_C2H2_2.
FT 340 362
zinc finger, C2H2-type (F/Y-X2-C-X2-5-C-X3-F/Y-X5-L-X2-H-X3-5-H) [1].
FT 340 362
PF00096; zf-C2H2.
FT 340 362
SM00355; c2h2final6.
FT 340 367
PS50157; ZINC_FINGER_C2H2_2.
FT 368 390
zinc finger, C2H2-type (F/Y-X2-C-X2-5-C-X3-F/Y-X5-L-X2-H-X3-5-H) [1].
FT 368 390
PF00096; zf-C2H2.
FT 368 390
SM00355; c2h2final6.
FT 368 395
PS50157; ZINC_FINGER_C2H2_2.
FT 396 419
zinc finger, C2H2-type (F/Y-X2-C-X2-5-C-X3-F/Y-X5-L-X2-H-X3-5-H) [1].
FT 396 419
PF00096; zf-C2H2.
FT 396 419
SM00355; c2h2final6.
FT 396 421
PS50157; ZINC_FINGER_C2H2_2.
XX
SF two isoforms p52 T05129 and p71 T05130 exist which can be due to alternative splicing in the 5'-end or usage of alternative promoter [1];
XX
EX adrenal gland (right and left),,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX amygdaloid body,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX aorta,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX appendix,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX blood,basophil granulocyte,Circulatory System & Hematopoietic System,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX blood,eosinophil granulocyte,Circulatory System & Hematopoietic System,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX blood,lymphocyte,Circulatory System & Hematopoietic System,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX blood,monocyte,Circulatory System & Hematopoietic System,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX blood,neutrophil granulocyte,Circulatory System & Hematopoietic System,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX bone marrow,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX brain,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX brain,,,fetal; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX caudate nucleus,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX cerebellum,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX cerebral cortex,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX colon,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX frontal lobe of medial and inferior surfaces,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX frontal lobe of superolateral face,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX heart,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX heart,,,fetal; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX hippocampus,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX kidney (right and left),,,adult; low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX kidney (right and left),,,fetal; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX liver,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX liver,,,fetal; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX lung (right and left),,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX lung (right and left),,,fetal; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX lymph node,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX major salivary glands,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX mammary gland,,,adult; high; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX minor salivary glands,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX muscles,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX myelencephalon,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX occipital lobe of medial and inferior surfaces,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX occipital lobe of superolateral face,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX ovary (right and left),,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX pancreas,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX pituitary gland of diencephalon,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX placenta,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX prostate gland,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX putamen,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX small intestine,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX spinal cord,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX spleen,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX spleen,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX stomach,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX substantia nigra,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX subthalamic nucleus,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX temporal lobe of medial and inferior surfaces,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX temporal lobe of superolateral face,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX testis (right and left),,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX thalamus,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX thymus,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX thymus,,,fetal; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX thyroid gland,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX trachea,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX tubular salivary gland,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX urinary bladder,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX uterus,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
XX
FF transcriptional activator (e.g. on binding to R12454) when ER-alpha T00261 is not present [1];
FF in contrast no transcriptional activation in the presence ER-alpha T00261 so ER-alpha seems to repress transcriptional activation [1];
FF can abrogate transcriptional activation of longer isoform T05130 in the presence of ER-alpha T00261 [1];
FF interacts with ER-alpha T00261 strongly in the presence of ligand (17-beta-estradiol) but only weakly in its absence [1];
XX
IN T00261 ER-alpha; human, Homo sapiens.
XX
BS R12454.
XX
DR TRANSPATH: MO000032973.
DR EMBL: AY049743;
DR UniProtKB: Q8TD17-2;
XX
RN [1]; RE0017823.
RX PUBMED: 11779858.
RA Conroy A. T., Sharma M., Holtz A. E., Wu C., Sun Z., Weigel R. J.
RT A novel zinc finger transcription factor with two isoforms that are differentially repressed by estrogen receptor-alpha
RL J. Biol. Chem. 277:9326-9334 (2002).
XX
//