AC T05130
XX
ID T05130
XX
DT 24.05.2002 (created); mas.
DT 06.06.2008 (updated); tgo.
CO Copyright (C), QIAGEN.
XX
FA ZER6 p71
XX
SY ZER 6; ZER-6; ZER6; Zinc Finger DNA Binding Protein p71; Zinc Finger Estrogen Receptor Interaction Clone 6.
XX
OS human, Homo sapiens
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates
XX
GE G004144 ZNF398; HGNC: ZNF398.
XX
CL C0001; CH; 2.3.3.38.2.1.
XX
SZ 642 AA; 71.3 kDa (cDNA) (calc.).
XX
SQ MAEAAPAPTSEWDSECLTSLQPLPLPTPPAANEAHLQTAAISLWTVVAAVQAIERKVEIH
SQ SRRLLHLEGRTGTAEKKLASCEKTVTELGNQLEGKWAVLGTLLQEYGLLQRRLENLENLL
SQ RNRNFWILRLPPGIKGDIPKVPVAFDDVSIYFSTPEWEKLEEWQKELYKNIMKGNYESLI
SQ SMDYAINQPDVLSQIQPEGEHNTEDQAGPEESEIPTDPSEEPGISTSDILSWIKQEEEPQ
SQ VGAPPESKESDVYKSTYADEELVIKAEGLARSSLCPEVPVPFSSPPAAAKDAFSDVAFKS
SQ QQSTSMTPFGRPATDLPEASEGQVTFTQLGSYPLPPPVGEQVFSCHHCGKNLSQDMLLTH
SQ QCSHATEHPLPCAQCPKHFTPQADLSSTSQDHASETPPTCPHCARTFTHPSRLTYHLRVH
SQ NSTERPFPCPDCPKRFADQARLTSHRRAHASERPFRCAQCGRSFSLKISLLLHQRGHAQE
SQ RPFSCPQCGIDFNGHSALIRHQMIHTGERPYPCTDCSKSFMRKEHLLNHRRLHTGERPFS
SQ CPHCGKSFIRKHHLMKHQRIHTGERPYPCSYCGRSFRYKQTLKDHLRSGHNGGCGGDSDP
SQ SGQPPNPPGPLITGLETSGLGVNTEGLETNQWYGEGSGGGVL
XX
SC translated from EMBL #AY049744
XX
FT 140 204 
PS50806; KRAB_RELATED.
FT 143 183 
PF01352; KRAB box.
FT 143 203 
SM00349; krabfinus.
FT 143 214 
PS50805; KRAB.
FT 343 364 
SM00355; c2h2final6.
FT 370 397 
PS50157; ZINC_FINGER_C2H2_2.
FT 398 420 
PF00096; zf-C2H2.
FT 398 420 
SM00355; c2h2final6.
FT 398 425 
PS50157; ZINC_FINGER_C2H2_2.
FT 427 449 
zinc finger, C2H2-type (F/Y-X-C-X2-5-C-X3-F/Y-X5-L-X2-H-X3-5-H) [1].
FT 427 449 PF00096; zf-C2H2.
FT 427 449 SM00355; c2h2final6.
FT 427 454 PS50157; ZINC_FINGER_C2H2_2.
FT 455 477 zinc finger, C2H2-type (F/Y-X-C-X2-5-C-X3-F/Y-X5-L-X2-H-X3-5-H) [1].
FT 455 477 PF00096; zf-C2H2.
FT 455 477 SM00355; c2h2final6.
FT 455 482 PS50157; ZINC_FINGER_C2H2_2.
FT 483 505 zinc finger, C2H2-type (F/Y-X-C-X2-5-C-X3-F/Y-X5-L-X2-H-X3-5-H) [1].
FT 483 505 PF00096; zf-C2H2.
FT 483 505 SM00355; c2h2final6.
FT 483 510 PS50157; ZINC_FINGER_C2H2_2.
FT 511 533 zinc finger, C2H2-type (F/Y-X-C-X2-5-C-X3-F/Y-X5-L-X2-H-X3-5-H) [1].
FT 511 533 PF00096; zf-C2H2.
FT 511 533 SM00355; c2h2final6.
FT 511 538 PS50157; ZINC_FINGER_C2H2_2.
FT 539 561 zinc finger, C2H2-type (F/Y-X-C-X2-5-C-X3-F/Y-X5-L-X2-H-X3-5-H) [1].
FT 539 561 PF00096; zf-C2H2.
FT 539 561 SM00355; c2h2final6.
FT 539 566 PS50157; ZINC_FINGER_C2H2_2.
FT 567 590 zinc finger, C2H2-type (F/Y-X-C-X2-5-C-X3-F/Y-X5-L-X2-H-X3-5-H) [1].
FT 567 590 PF00096; zf-C2H2.
FT 567 590 SM00355; c2h2final6.
FT 567 592 PS50157; ZINC_FINGER_C2H2_2.
XX
SF two isoforms p52 T05129 and p71 T05130 exist which can be due to alternative splicing in the 5'-end or usage of alternative promoter [1];
SF N-terminus contains HUB-1 domain (originally identified as a transcriptional repressive domain) which could inhibit the interaction with ER-alpha that is in contrast observed with shorter isoform p52 T05129 which lacks this domain [1];
XX
EX adrenal gland (right and left),,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX amygdaloid body,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX aorta,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX appendix,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX blood,basophil granulocyte,Circulatory System & Hematopoietic System,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX blood,eosinophil granulocyte,Circulatory System & Hematopoietic System,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX blood,lymphocyte,Circulatory System & Hematopoietic System,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX blood,monocyte,Circulatory System & Hematopoietic System,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX blood,neutrophil granulocyte,Circulatory System & Hematopoietic System,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX bone marrow,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX brain,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX brain,,,fetal; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX caudate nucleus,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX cerebellum,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX cerebral cortex,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX colon,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX frontal lobe of medial and inferior surfaces,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX frontal lobe of superolateral face,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX heart,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX heart,,,fetal; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX hippocampus,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX kidney (right and left),,,adult; low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX kidney (right and left),,,fetal; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX liver,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX liver,,,fetal; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX lung (right and left),,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX lung (right and left),,,fetal; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX lymph node,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX major salivary glands,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX mammary gland,,,adult; high; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX minor salivary glands,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX muscles,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX myelencephalon,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX occipital lobe of medial and inferior surfaces,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX occipital lobe of superolateral face,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX ovary (right and left),,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX pancreas,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX pituitary gland of diencephalon,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX placenta,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX prostate gland,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX putamen,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX small intestine,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX spinal cord,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX spleen,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX spleen,,,fetal; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX stomach,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX substantia nigra,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX subthalamic nucleus,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX temporal lobe of medial and inferior surfaces,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX temporal lobe of superolateral face,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX testis (right and left),,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX thalamus,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX thymus,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX thymus,,,fetal; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX thyroid gland,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX trachea,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX tubular salivary gland,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX urinary bladder,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
EX uterus,,,adult; very low; RNA-in situ hybridization (not further specified); RNA (undefined); [1].
XX
FF transcriptional activator, also in the presence of ER-alpha T00261 [1];
FF smaller isoform T05129 can abrogate transcriptional activation in the presence of ER-alpha T00261 [1];
FF does not interact with ER-alpha T00261 either with or without ligand (17-beta-estradiol) of the latter factor [1];
XX
DR TRANSPATH: MO000032974.
DR EMBL: AY049744;
DR UniProtKB: Q8TD17-1;
XX
RN [1]; RE0017823.
RX PUBMED: 11779858.
RA Conroy A. T., Sharma M., Holtz A. E., Wu C., Sun Z., Weigel R. J.
RT A novel zinc finger transcription factor with two isoforms that are differentially repressed by estrogen receptor-alpha
RL J. Biol. Chem. 277:9326-9334 (2002).
XX
//