AC T05149
XX
ID T05149
XX
DT 17.06.2002 (created); mas.
DT 17.06.2013 (updated); mkl.
CO Copyright (C), QIAGEN.
XX
FA ZAC-isoform1
XX
SY DJ468K18.3; lost on transformation; LOT-1; LOT1; PLAGL1; Pleiomorphic Adenoma Gene-like 1; Zac 1; Zac Delta 2 Protein; Zinc Finger Protein DJ468K18.3.
XX
OS human, Homo sapiens
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates
XX
GE G004489 PLAGL1; HGNC: PLAGL1.
XX
CL C0034; zin; 2.3.3.25.3.1.
XX
SZ 463 AA; 50.8 kDa (cDNA) (calc.).
XX
SQ MATFPCQLCGKTFLTLEKFTIHNYSHSRERPYKCVQPDCGKAFVSRYKLMRHMATHSPQK
SQ SHQCAHCEKTFNRKDHLKNHLQTHDPNKMAFGCEECGKKYNTMLGYKRHLALHAASSGDL
SQ TCGVCALELGSTEVLLDHLKAHAEEKPPSGTKEKKHQCDHCERCFYTRKDVRRHLVVHTG
SQ CKDFLCQFCAQRFGRKDHLTRHTKKTHSQELMKESLQTGDLLSTFHTISPSFQLKAAALP
SQ PFPLGASAQNGLASSLPAEVHSLTLSPPEQAAQPMQPLPESLASLHPSVSPGSPPPPLPN
SQ HKYNTTSTSYSPLASLPLKADTKGFCNISLFEDLPLQEPQSPQKLNPGFDLAKGNAGKVN
SQ LPKELPADAVNLTIPASLDLSPLLGFWQLPPPATQNTFGNSTLALGPGESLPHRLSCLGQ
SQ QQQEPPLAMGTVSLGQLPLPPIPHVFSAGTGSAILPHFHHAFR
XX
SC translated from EMBL #AJ006354
XX
FT 4 26 
PF00096; zf-C2H2.
FT 4 26 
SM00355; c2h2final6.
FT 4 31 
PS50157; ZINC_FINGER_C2H2_2.
FT 32 56 
PF00096; zf-C2H2.
FT 32 56 
SM00355; c2h2final6.
FT 32 61 
PS50157; ZINC_FINGER_C2H2_2.
FT 62 84 
PF00096; zf-C2H2.
FT 62 84 
SM00355; c2h2final6.
FT 62 89 
PS50157; ZINC_FINGER_C2H2_2.
FT 91 113 
PF00096; zf-C2H2.
FT 91 113 SM00355; c2h2final6.
FT 91 118 PS50157; ZINC_FINGER_C2H2_2.
FT 120 142 SM00355; c2h2final6.
FT 120 147 PS50157; ZINC_FINGER_C2H2_2.
FT 156 178 PF00096; zf-C2H2.
FT 156 178 SM00355; c2h2final6.
FT 156 183 PS50157; ZINC_FINGER_C2H2_2.
FT 184 207 PF00096; zf-C2H2.
FT 184 207 SM00355; c2h2final6.
FT 184 212 PS50157; ZINC_FINGER_C2H2_2.
XX
SF ZAC-isoform1 (EMBL #AJ006354) and LOT-1 (EMBL #U72621) are identical except in one residue at pos. 81 (L versus F);
SF >55% amino acid identity in with mouse homolog T05150 between pos. 1 and 425;
SF human protein sequence (463 aa) shorter than sequence of mouse ortholog T05150 (704 aa) with two major differences: a proline-repeat (pos. 278-279: 104 aa) and Glutamate-cluster (pos.422-423: 127 aa) missing compared to mouse homolog [2];
XX
EX adrenal gland (right and left),,,adult; very high; Northern blot; RNA (undefined); [2].
EX amygdaloid body,,,adult; very low; Northern blot; RNA (undefined); [2].
EX aorta,,,adult; high; Northern blot; RNA (undefined); [2].
EX blood,basophil granulocyte,Circulatory System & Hematopoietic System,adult; low; Northern blot; RNA (undefined); [2].
EX blood,eosinophil granulocyte,Circulatory System & Hematopoietic System,adult; low; Northern blot; RNA (undefined); [2].
EX blood,lymphocyte,Circulatory System & Hematopoietic System,adult; low; Northern blot; RNA (undefined); [2].
EX blood,monocyte,Circulatory System & Hematopoietic System,adult; low; Northern blot; RNA (undefined); [2].
EX blood,neutrophil granulocyte,Circulatory System & Hematopoietic System,adult; low; Northern blot; RNA (undefined); [2].
EX bone marrow,,,adult; medium; Northern blot; RNA (undefined); [2].
EX brain,,,adult; low; Northern blot; RNA (undefined); [2].
EX caudate nucleus,,,adult; very low; Northern blot; RNA (undefined); [2].
EX cerebellum,,,adult; very low; Northern blot; RNA (undefined); [2].
EX cerebral cortex of cerebral hemisphere,,,adult; low; Northern blot; RNA (undefined); [2].
EX cerebral cortex,,,adult; low; Northern blot; RNA (undefined); [2].
EX colon,,,adult; high; Northern blot; RNA (undefined); [2].
EX frontal lobe of medial and inferior surfaces,,,adult; very low; Northern blot; RNA (undefined); [2].
EX frontal lobe of superolateral face,,,adult; very low; Northern blot; RNA (undefined); [2].
EX heart,,,adult; high; Northern blot; RNA (undefined); [2].
EX hippocampus,,,adult; very low; Northern blot; RNA (undefined); [2].
EX kidney (right and left),,,adult; very high; Northern blot; RNA (undefined); [2].
EX liver,,,adult; low; Northern blot; RNA (undefined); [2].
EX lung (right and left),,,adult; high; Northern blot; RNA (undefined); [2].
EX lymph node,,,adult; high; Northern blot; RNA (undefined); [2].
EX major salivary glands,,,adult; medium; Northern blot; RNA (undefined); [2].
EX mammary gland,,,adult; high; Northern blot; RNA (undefined); [2].
EX minor salivary glands,,,adult; medium; Northern blot; RNA (undefined); [2].
EX muscles,,,adult; low; Northern blot; RNA (undefined); [2].
EX myelencephalon,,,adult; very low; Northern blot; RNA (undefined); [2].
EX occipital lobe of medial and inferior surfaces,,,adult; low; Northern blot; RNA (undefined); [2].
EX occipital lobe of superolateral face,,,adult; low; Northern blot; RNA (undefined); [2].
EX ovary (right and left),,,adult; high; Northern blot; RNA (undefined); [2].
EX pancreas,,,adult; high; Northern blot; RNA (undefined); [2].
EX pituitary gland of diencephalon,,,adult; very high; Northern blot; RNA (undefined); [2].
EX placenta,,,adult; very high; Northern blot; RNA (undefined); [2].
EX prostate gland,,,adult; high; Northern blot; RNA (undefined); [2].
EX putamen,,,adult; very low; Northern blot; RNA (undefined); [2].
EX small intestine,,,adult; high; Northern blot; RNA (undefined); [2].
EX spinal cord,,,adult; low; Northern blot; RNA (undefined); [2].
EX spleen,,,adult; high; Northern blot; RNA (undefined); [2].
EX stomach,,,adult; high; Northern blot; RNA (undefined); [2].
EX substantia nigra,,,adult; very low; Northern blot; RNA (undefined); [2].
EX subthalamic nucleus,,,adult; very low; Northern blot; RNA (undefined); [2].
EX temporal lobe of medial and inferior surfaces,,,adult; very low; Northern blot; RNA (undefined); [2].
EX temporal lobe of superolateral face,,,adult; very low; Northern blot; RNA (undefined); [2].
EX testis (right and left),,,adult; medium; Northern blot; RNA (undefined); [2].
EX thalamus,,,adult; low; Northern blot; RNA (undefined); [2].
EX thymus,,,adult; medium; Northern blot; RNA (undefined); [2].
EX thyroid gland,,,adult; high; Northern blot; RNA (undefined); [2].
EX trachea,,,adult; high; Northern blot; RNA (undefined); [2].
EX urinary bladder,,,adult; high; Northern blot; RNA (undefined); [2].
EX uterus,,,adult; high; Northern blot; RNA (undefined); [2].
XX
FF activator (in transactivation experiments) [2];
FF can induce cell cycle arrest in G1 (in SaOS-2 cell) [2];
FF antiproliferative: can inhibit growth of tumor cells (in SaOS-2 cells) and good candidate for tumor suppressor, intracellular location: mainly in cell nucleus (of SaOS-2 cells) [2] [3];
FF can induce apoptosis (of SaOS2-cells) [2];
FF expression seems to be primarily mediated via EGF receptor or a related pathway [4];
XX
IN T23091 p300; Mammalia.
XX
BS R12715.
XX
DR TRANSPATH: MO000032984.
DR EMBL: AJ006354;
DR EMBL: U72621;
DR UniProtKB: Q9UM63-1;
XX
RN [1]; RE0017855.
RX PUBMED: 12031496.
RA Rodriguez-Henche N., Jamen F., Leroy C., Bockaert J., Brabet P.
RT Transcription of the mouse PAC1 receptor gene: cell-specific expression and regulation by Zac1
RL Biochim. Biophys. Acta 1576:157-162 (2002).
RN [2]; RE0017856.
RX PUBMED: 9671765.
RA Varrault A., Ciani E., Apiou F., Bilanges B., Hoffmann A., Pantaloni C., Bockaert J., Spengler D., Journot L.
RT hZAC encodes a zinc finger protein with antiproliferative properties and maps to a chromosomal region frequently lost in cancer
RL Proc. Natl. Acad. Sci. USA 95:8835-8840 (1998).
RN [3]; RE0017859.
RX PUBMED: 9150364.
RA Abdollahi A., Roberts D., Godwin A. K., Schultz D. C., Sonoda G., Testa J. R., Hamilton T. C.
RT Identification of a zinc-finger gene at 6q25: a chromosomal region implicated in development of many solid tumors
RL Oncogene 14:1973-1979 (1997).
RN [4]; RE0017860.
RX PUBMED: 10597250.
RA Abdollahi A., Bao R., Hamilton T. C.
RT LOT1 is a growth suppressor gene down-regulated by the epidermal growth factor receptor ligands and encodes a nuclear zinc-finger protein
RL Oncogene 18:6477-6487 (1999).
RN [5]; RE0049195.
RX PUBMED: 16809786.
RA Hoffmann A., Barz T., Spengler D.
RT Multitasking C2H2 zinc fingers link Zac DNA binding to coordinated regulation of p300-histone acetyltransferase activity.
RL Mol. Cell. Biol. 26:5544-5557 (2006).
XX
//