TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T05989 XX ID T05989 XX DT 28.05.2004 (created); oke. DT 11.11.2010 (updated); din. CO Copyright (C), QIAGEN. XX FA deltaFosB XX SY short variant of FosB. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G009540 FOSB; HGNC: FOSB. XX CL C0008; bZIP. XX SZ 338 AA; 35.9 kDa (cDNA) (calc.). XX SQ MFQAFPGDYDSGSRCSSSPSAESQYLSSVDSFGSPPTAAASQECAGLGEMPGSFVPTVTA SQ ITTSQDLQWLVQPTLISSMAQSQGQPLASQPPVVDPYDMPGTSYSTPGMSGYSSGGASGS SQ GGPSTSGTTSGPGPARPARARPRRPREETLTPEEEEKRRVRRERNKLAAAKCRNRRRELT SQ DRLQAETDQLEEEKAELESEIAELQKEKERLEFVLVAHKPGCKIPYEEGPGPGPLAEVRD SQ LPGSAPAKEDGFSWLLPPPPPPPLPFQTSQDAPPNLTASLFTHSEVQVLGDPFPVVNPSY SQ TSSFVLTCPEVSAFAGAQRTSGSDQPSDPLNSPSLLAL XX SC Swiss-Prot#P53539 XX SF for animal models, see mouse deltaFosB T02198 and rat deltaFosB T05987; XX CP brain; vein endothelial cells [5]. XX FF plays an important function in addiction of brain to drugs, for animal models see [2] [3] [4] [6]; FF in umbilical vein endothelial cells mRNA is induced by growth factors VEGF and PlGF [5]; XX MX M00517 V$AP1_01. MX M00924 V$AP1_Q2_01. MX M00926 V$AP1_Q4_01. MX M00925 V$AP1_Q6_01. XX DR TRANSPATH: MO000042238. DR UniProtKB: P53539; FOSB_HUMAN. XX RN [1]; RE0004889. RX PUBMED: 1648531. RA Mumberg D., Lucibello F. C., Schuermann M., Mueller R. RT Alternative splicing of fosB transcripts results in differentially expressed mRNAs encoding functionally antagonistic proteins RL Genes Dev. 5:1212-1223 (1991). RN [2]; RE0024325. RX PUBMED: 9294222. RA Hiroi N., Brown J. R., Haile C. N., Ye H., Greenberg M. E., Nestler E. J. RT FosB mutant mice: loss of chronic cocaine induction of Fos-related proteins and heightened sensitivity to cocaine's psychomotor and rewarding effects. RL Proc. Natl. Acad. Sci. USA 94:10397-10402 (1997). RN [3]; RE0024326. RX PUBMED: 10499584. RA Kelz M. B., Chen J., Carlezon WA J. r., Whisler K., Gilden L., Beckmann A. M., Steffen C., Zhang Y. J., Marotti L., Self D. W., Tkatch T., Baranauskas G., Surmeier D. J., Neve R. L., Duman R. S., Picciotto M. R., Nestler E. J. RT Expression of the transcription factor deltaFosB in the brain controls sensitivity to cocaine. RL Nature 401:272-276 (1999). RN [4]; RE0024327. RX PUBMED: 11572966. RA Nestler E. J., Barrot M., Self D. W. RT DeltaFosB: a sustained molecular switch for addiction. RL Proc. Natl. Acad. Sci. USA 98:11042-11046 (2001). RN [5]; RE0024333. RX PUBMED: 14741347. RA Holmes D. I., Zachary I. RT Placental growth factor induces FosB and c-Fos gene expression via Flt-1 receptors. RL FEBS Lett. 557:93-98 (2004). RN [6]; RE0024334. RX PUBMED: 11268215. RA Bibb J. A., Chen J., Taylor J. R., Svenningsson P., Nishi A., Snyder G. L., Yan Z., Sagawa Z. K., Ouimet C. C., Nairn A. C., Nestler E. J., Greengard P. RT Effects of chronic exposure to cocaine are regulated by the neuronal protein Cdk5. RL Nature 410:376-380 (2001). XX //