AC T02198
XX
ID T02198
XX
DT 14.07.1997 (created); ewi.
DT 11.11.2010 (updated); din.
CO Copyright (C), QIAGEN.
XX
FA deltaFosB
XX
SY DeltaFosB; FosB-S; FosB/SF; FosB2; short variant of FosB.
XX
OS mouse, Mus musculus
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae
XX
GE G000509 Fosb.
XX
CL C0008; bZIP.
XX
SZ 338 AA; 36.0 kDa (cDNA) (calc.).
XX
SQ MFQAFPGDYDSGSRCSSSPSAESQYLSSVDSFGSPPTAAASQECAGLGEMPGSFVPTVTA
SQ ITTSQDLQWLVQPTLISSMAQSQGQPLASQPPAVDPYDMPGTSYSTPGLSAYSTGGASGS
SQ GGPSTSTTTSGPVSARPARARPRRPREETLTPEEEEKRRVRRERNKLAAAKCRNRRRELT
SQ DRLQAETDQLEEEKAELESEIAELQKEKERLEFVLVAHKPGCKIPYEEGPGPGPLAEVRD
SQ LPGSTSAKEDGFGWLLPPPPPPPLPFQSSRDAPPNLTASLFTHSEVQVLGDPFPVVSPSY
SQ TSSFVLTCPEVSAFAGAQRTSGSEQPSDPLNSPSLLAL
XX
SC Swiss-Prot#P13346
XX
SF no homodimerization, but heterodimerization with JunD or JunB;
SF binds to AP-1 sites, most likely as a heterodimer with JunD or JunB [11] [13] [14];
SF splice variant: FosB T00291 [1] [2] [3] [5] [8];
SF deltaFosB lacks a portion of the C-terminal transactivation domain present in FosB;
SF mRNA for deltaFosB produces three variants of proteins, 37, 35 and 33 kDa, as a result of the alternative AUG codons [14];
SF the 37 and 35 kDa deltaFosB proteins are extremely stable, they are detectable several days after induction [14];
XX
CP brain, especially striatum (region important for addiction) [10] [12].
XX
FF activator, either similar to FosB or weaker [1] [8];
FF does not repress c-fos expression [1];
FF blunts c-Fos and FosB activities and reduces transformation by v-Fos, c-Fos, or FosB [2] [3] [8] [9];
FF does not reduce cell proliferation [1];
FF it is able to transform, e. g., Rat-1A cells consistent with the role of N-terminal sequences in transformation [4] [5];
FF plays an important role in behavioral responses to cocaine [10];
FF may mediate long-lasting changes in gene expression that increase sensitivity to cocaine and thus contribute to brain addiction [11] [12];
FF induces expression of glutamate receptor subunit GluR2 [11];
FF might decrease expression of dynorphin [12];
FF induces expression of the cdk5 gene [13] [15];
XX
IN T00131 c-Jun; mouse, Mus musculus.
IN T00132 c-Jun; rat, Rattus norvegicus.
IN T00133 c-Jun; human, Homo sapiens.
IN T00134 c-Jun; chick, Gallus gallus.
IN T00135 c-Jun; hamster, Cricetulus sp.
IN T00436 JunB; mouse, Mus musculus.
IN T00437 JunD; mouse, Mus musculus.
XX
MX M00517 V$AP1_01.
MX M00924 V$AP1_Q2_01.
MX M00926 V$AP1_Q4_01.
MX M00925 V$AP1_Q6_01.
XX
DR TRANSPATH: MO000026218.
DR UniProtKB: P13346;
XX
RN [1]; RE0004881.
RX PUBMED: 1922060.
RA Dobrazanski P., Noguchi T., Kovary K., Rizzo C. A., Lazo P. S., Bravo R.
RT Both products of the fosB gene, FosB and its short form, FosB/SF, are transcriptional activators in fibroblasts
RL Mol. Cell. Biol. 11:5470-5478 (1991).
RN [2]; RE0004882.
RX PUBMED: 1900040.
RA Nakabeppu Y., Nathans D.
RT A naturally occurring truncated form of FosB that inhibits Fos/Jun transcriptional activity
RL Cell 64:751-759 (1991).
RN [3]; RE0004883.
RX PUBMED: 1905017.
RA Yen J., Wisdom R. M., Tratner I., Verma I. M.
RT An alternative spliced form of FosB is a negative regulator of transcriptional activation and transformation by Fos proteins
RL Proc. Natl. Acad. Sci. USA 88:5077-5081 (1991).
RN [4]; RE0004884.
RX PUBMED: 8474434.
RA Wisdom R., Verma I. M.
RT Proto-oncogene FosB: the amino terminus encodes a regulatory function required for transformation
RL Mol. Cell. Biol. 13:2635-2643 (1993).
RN [5]; RE0004885.
RX PUBMED: 8321220.
RA Nakabeppu Y., Oda S., Sekiguchi M.
RT Proliferative activation of quiescent Rat-1A cells by deltaFosB
RL Mol. Cell. Biol. 13:4157-4166 (1993).
RN [6]; RE0004887.
RX PUBMED: 8137828.
RA Jooss K. U., Funk M., Mueller R.
RT An autonomous N-terminal transactivation domain in Fos protein plays a crucial role in transformation
RL EMBO J. 13:1467-1475 (1994).
RN [7]; RE0004888.
RX PUBMED: 8070410.
RA Metz R., Kouzarides T., Bravo R.
RT A C-terminal domain in FosB, absent in FosB/SF and Fra-1, which is able to interact with the TATA binding protein, is required for altered cell growth
RL EMBO J. 13:3832-3842 (1994).
RN [8]; RE0004889.
RX PUBMED: 1648531.
RA Mumberg D., Lucibello F. C., Schuermann M., Mueller R.
RT Alternative splicing of fosB transcripts results in differentially expressed mRNAs encoding functionally antagonistic proteins
RL Genes Dev. 5:1212-1223 (1991).
RN [9]; RE0004890.
RX PUBMED: 1373118.
RA Wisdom R., Verma I. M.
RT Transformation by FosB requires a trans-activation domain missing in FosB2 that can be substituted by heterologous activation domains
RL Genes Dev. 6:667-675 (1992).
RN [10]; RE0024325.
RX PUBMED: 9294222.
RA Hiroi N., Brown J. R., Haile C. N., Ye H., Greenberg M. E., Nestler E. J.
RT FosB mutant mice: loss of chronic cocaine induction of Fos-related proteins and heightened sensitivity to cocaine's psychomotor and rewarding effects.
RL Proc. Natl. Acad. Sci. USA 94:10397-10402 (1997).
RN [11]; RE0024326.
RX PUBMED: 10499584.
RA Kelz M. B., Chen J., Carlezon WA J. r., Whisler K., Gilden L., Beckmann A. M., Steffen C., Zhang Y. J., Marotti L., Self D. W., Tkatch T., Baranauskas G., Surmeier D. J., Neve R. L., Duman R. S., Picciotto M. R., Nestler E. J.
RT Expression of the transcription factor deltaFosB in the brain controls sensitivity to cocaine.
RL Nature 401:272-276 (1999).
RN [12]; RE0024327.
RX PUBMED: 11572966.
RA Nestler E. J., Barrot M., Self D. W.
RT DeltaFosB: a sustained molecular switch for addiction.
RL Proc. Natl. Acad. Sci. USA 98:11042-11046 (2001).
RN [13]; RE0024328.
RX PUBMED: 11124971.
RA Chen J., Zhang Y., Kelz M. B., Steffen C., Ang E. S., Zeng L., Nestler E. J.
RT Induction of cyclin-dependent kinase 5 in the hippocampus by chronic electroconvulsive seizures: role of [Delta]FosB.
RL J. Neurosci. 20:8965-8971 (2000).
RN [14]; RE0024332.
RX PUBMED: 9185531.
RA Chen J., Kelz M. B., Hope B. T., Nakabeppu Y., Nestler E. J.
RT Chronic Fos-related antigens: stable variants of deltaFosB induced in brain by chronic treatments.
RL J. Neurosci. 17:4933-4941 (1997).
RN [15]; RE0024334.
RX PUBMED: 11268215.
RA Bibb J. A., Chen J., Taylor J. R., Svenningsson P., Nishi A., Snyder G. L., Yan Z., Sagawa Z. K., Ouimet C. C., Nairn A. C., Nestler E. J., Greengard P.
RT Effects of chronic exposure to cocaine are regulated by the neuronal protein Cdk5.
RL Nature 410:376-380 (2001).
XX
//