AC T08632
XX
ID T08632
XX
DT 07.03.2006 (created); man.
CO Copyright (C), QIAGEN.
XX
FA PPARalpha-isoform1
XX
SY NR1C1; peroxisome proliferator-activated receptor alpha; PPARalpha.
XX
OS human, Homo sapiens
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates
XX
GE G002888 PPARA; HGNC: PPARA.
XX
CL C0002; CC (rec).
XX
SZ 468 AA; 52.2 kDa (cDNA) (calc.).
XX
SQ MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSC
SQ PGSDGSVITDTLSPASSPSSVTYPVVPGSVDESPSGALNIECRICGDKASGYHYGVHACE
SQ GCKGFFRRTIRLKLVYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSE
SQ KAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFV
SQ IHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANL
SQ DLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFD
SQ FAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDI
SQ FLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY
XX
SC Swiss-Prot#Q07869
XX
FT 99 169 
SM00399; c4gold.
FT 99 173 
PS51030; NUCLEAR_REC_DBD_2.
FT 100 174 
PF00105; Zinc finger, C4 type (two domains).
FT 160 459 
PF00478; IMP dehydrogenase / GMP reductase domai.
FT 278 437 
SM00430; holi.
FT 281 463 
PF00104; Ligand-binding domain of nuclear hormon.
XX
IN T02752 LXR-alpha; human, Homo sapiens.
IN T09029 LXR-beta; human, Homo sapiens.
IN T04687 NCOR1; human, Homo sapiens.
IN T01516 Pit-1B; rat, Rattus norvegicus.
XX
MX M00242 V$PPARA_01.
MX M00518 V$PPARA_02.
MX M01282 V$PPARA_Q6.
MX M00763 V$PPARDR1_Q2.
XX
BS R13001.
BS R33256.
BS R33257.
XX
DR TRANSPATH: MO000078802.
DR EMBL: L02932;
DR UniProtKB: Q07869; PPARA_HUMAN.
XX
RN [1]; RE0038430.
RX PUBMED: 12955147.
RA Fu J., Gaetani S., Oveisi F., Lo Verme J., Serrano A., Rodriguez de Fonseca F., Rosengarth A., Luecke H., Di Giacomo B., Tarzia G., Piomelli D.
RT Oleylethanolamide regulates feeding and body weight through activation of the nuclear receptor PPAR-alpha
RL Nature 425:90-3 (2003).
RN [2]; RE0040896.
RX PUBMED: 11226238.
RA Wolfrum C., Borrmann C. M., Borchers T., Spener F.
RT Fatty acids and hypolipidemic drugs regulate peroxisome proliferator-activated receptors alpha - and gamma -mediated gene expression via liver fatty acid binding protein: A signaling path to the nucleus
RL Proc. Natl. Acad. Sci. USA 98:2323-2328 (2001).
RN [3]; RE0041772.
RX PUBMED: 10187842.
RA Juge-Aubry C. E., Hammar E., Siegrist-Kaiser C., Pernin A., Takeshita A., Chin W. W., Burger A. G., Meier C. A.
RT Regulation of the transcriptional activity of the peroxisome proliferator-activated receptor alpha by phosphorylation of a ligand-independent trans-activating domain
RL J. Biol. Chem. 274:10505-10 (1999).
RN [4]; RE0047743.
RX PUBMED: 15610520.
RA Flores A. M., Li L., Aneskievich B. J.
RT Isolation and functional analysis of a keratinocyte-derived, ligand-regulated nuclear receptor comodulator.
RL J. Invest. Dermatol 123:1092-1101 (2004).
RN [5]; RE0047832.
RX PUBMED: 15615782.
RA Patel H., Truant R., Rachubinski R. A., Capone J. P.
RT Activity and subcellular compartmentalization of peroxisome proliferator-activated receptor alpha are altered by the centrosome-associated protein CAP350.
RL J. Cell Sci. 118:175-186 (2005).
RN [6]; RE0047844.
RX PUBMED: 15722453.
RA Yue L., Ye F., Gui C., Luo H., Cai J., Shen J., Chen K., Shen X., Jiang H.
RT Ligand-binding regulation of LXR/RXR and LXR/PPAR heterodimerizations: SPR technology-based kinetic analysis correlated with molecular dynamics simulation.
RL Protein Sci. 14:812-822 (2005).
RN [7]; RE0047849.
RX PUBMED: 12118000.
RA Blanquart C., Barbier O., Fruchart J. C., Staels B., Glineur C.
RT Peroxisome proliferator-activated receptor alpha (PPARalpha ) turnover by the ubiquitin-proteasome system controls the ligand-induced expression level of its target genes.
RL J. Biol. Chem. 277:37254-37259 (2002).
RN [8]; RE0049914.
RX PUBMED: 11923221.
RA Heim M., Johnson J., Boess F., Bendik I., Weber P., Hunziker W., Fluhmann B.
RT Phytanic acid, a natural peroxisome proliferator-activated receptor (PPAR) agonist, regulates glucose metabolism in rat primary hepatocytes.
RL FASEB J. 16:718-720 (2002).
RN [9]; RE0050025.
RX PUBMED: 10198642.
RA Xu H. E., Lambert M. H., Montana V. G., Parks D. J., Blanchard S. G., Brown P. J., Sternbach D. D., Lehmann J. M., Wisely G. B., Willson T. M., Kliewer S. A., Milburn M. V.
RT Molecular recognition of fatty acids by peroxisome proliferator-activated receptors.
RL Mol. Cell 3:397-403 (1999).
RN [10]; RE0050040.
RX PUBMED: 10760508.
RA Delerive P., Furman C., Teissier E., Fruchart J., Duriez P., Staels B.
RT Oxidized phospholipids activate PPARalpha in a phospholipase A2-dependent manner.
RL FEBS Lett. 471:34-38 (2000).
RN [11]; RE0050070.
RX PUBMED: 7592593.
RA Yu K., Bayona W., Kallen C. B., Harding H. P., Ravera C. P., McMahon G., Brown M., Lazar M. A.
RT Differential activation of peroxisome proliferator-activated receptors by eicosanoids.
RL J. Biol. Chem. 270:23975-23983 (1995).
RN [12]; RE0050080.
RX PUBMED: 10403814.
RA Murakami K., Ide T., Suzuki M., Mochizuki T., Kadowaki T.
RT Evidence for direct binding of fatty acids and eicosanoids to human peroxisome proliferators-activated receptor alpha.
RL Biochem. Biophys. Res. Commun. 260:609-613 (1999).
RN [13]; RE0050147.
RX PUBMED: 12124379.
RA Cowart L. A., Wei S., Hsu M. H., Johnson E. F., Krishna M. U., Falck J. R., Capdevila J. H.
RT The CYP4A isoforms hydroxylate epoxyeicosatrienoic acids to form high affinity peroxisome proliferator-activated receptor ligands.
RL J. Biol. Chem. 277:35105-35112 (2002).
RN [14]; RE0050176.
RX PUBMED: 17431031.
RA Ng V. Y., Huang Y., Reddy L. M., Falck J. R., Lin E. T., Kroetz D. L.
RT Cytochrome P450 Eicosanoids are Activators of Peroxisome Proliferator-Activated Receptor Alpha (PPAR{alpha}).
RL Drug Metab. Dispos. 35:1126-1134 (2007).
RN [15]; RE0050208.
RX PUBMED: 15701701.
RA Schopfer F. J., Lin Y., Baker P. R., Cui T., Garcia-Barrio M., Zhang J., Chen K., Chen Y. E., Freeman B. A.
RT Nitrolinoleic acid: an endogenous peroxisome proliferator-activated receptor gamma ligand.
RL Proc. Natl. Acad. Sci. USA 102:2340-2345 (2005).
RN [16]; RE0050229.
RX PUBMED: 11943173.
RA Takahashi N., Kawada T., Goto T., Yamamoto T., Taimatsu A., Matsui N., Kimura K., Saito M., Hosokawa M., Miyashita K., Fushiki T.
RT Dual action of isoprenols from herbal medicines on both PPARgamma and PPARalpha in 3T3-L1 adipocytes and HepG2 hepatocytes.
RL FEBS Lett. 514:315-322 (2002).
RN [17]; RE0050270.
RX PUBMED: 15465922.
RA Lo Verme J., Fu J., Astarita G., La Rana G., Russo R., Calignano A., Piomelli D.
RT The nuclear receptor peroxisome proliferator-activated receptor-alpha mediates the anti-inflammatory actions of palmitoylethanolamide.
RL Mol. Pharmacol. 67:15-19 (2005).
RN [18]; RE0050299.
RX PUBMED: 16227625.
RA Baker P. R., Lin Y., Schopfer F. J., Woodcock S. R., Groeger A. L., Batthyany C., Sweeney S., Long M. H., Iles K. E., Baker L. M., Branchaud B. P., Chen Y. E., Freeman B. A.
RT Fatty acid transduction of nitric oxide signaling: multiple nitrated unsaturated fatty acid derivatives exist in human blood and urine and serve as endogenous peroxisome proliferator-activated receptor ligands.
RL J. Biol. Chem. 280:42464-42475 (2005).
RN [19]; RE0050313.
RX PUBMED: 10428978.
RA Moya-Camarena S. Y., Vanden Heuvel J. P., Blanchard S. G., Leesnitzer L. A., Belury M. A.
RT Conjugated linoleic acid is a potent naturally occurring ligand and activator of PPARalpha.
RL J. Lipid Res. 40:1426-1433 (1999).
RN [20]; RE0050363.
RX PUBMED: 16202384.
RA Goto T., Takahashi N., Kato S., Egawa K., Ebisu S., Moriyama T., Fushiki T., Kawada T.
RT Phytol directly activates peroxisome proliferator-activated receptor alpha (PPARalpha) and regulates gene expression involved in lipid metabolism in PPARalpha-expressing HepG2 hepatocytes.
RL Biochem. Biophys. Res. Commun. 337:440-445 (2005).
RN [21]; RE0050659.
RX PUBMED: 15131257.
RA Blanquart C., Mansouri R., Paumelle R., Fruchart J. C., Staels B., Glineur C.
RT The protein kinase C signaling pathway regulates a molecular switch between transactivation and transrepression activity of the peroxisome proliferator-activated receptor alpha.
RL Mol. Endocrinol. 18:1906-1918 (2004).
RN [22]; RE0050850.
RX PUBMED: 8828512.
RA Shalev A., Siegrist-Kaiser C. A., Yen P. M., Wahli W., Burger A. G., Chin W. W., Meier C. A.
RT The peroxisome proliferator-activated receptor alpha is a phosphoprotein: regulation by insulin.
RL Endocrinology 137:4499-4502 (1996).
RN [23]; RE0066859.
RX PUBMED: 20400503.
RA Narala V. R., Adapala R. K., Suresh M. V., Brock T. G., Peters-Golden M., Reddy R. C.
RT Leukotriene B4 is a physiologically relevant endogenous peroxisome proliferator-activated receptor-{alpha} agonist.
RL J. Biol. Chem. 285:22067-22074 (2010).
RN [24]; RE0067377.
RX PUBMED: 19955185.
RA Pourcet B., Pineda-Torra I., Derudas B., Staels B., Glineur C.
RT SUMOylation of human peroxisome proliferator-activated receptor alpha inhibits its trans-activity through the recruitment of the nuclear corepressor NCoR.
RL J. Biol. Chem. 285:5983-5992 (2010).
XX
//