AC T09029
XX
ID T09029
XX
DT 08.06.2006 (created); din.
DT 22.01.2014 (updated); spk.
CO Copyright (C), QIAGEN.
XX
FA LXR-beta
XX
SY LXR B; LXRB; NER; NR1H2; nuclear orphan receptor LXR-beta; orphan nuclear receptor OR-1; oxysterol receptor LXR-beta; ubiquitously expressed nuclear receptor; UR.
XX
OS human, Homo sapiens
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates
XX
GE G002742 NR1H2; HGNC: NR1H2.
XX
CL C0002; CC (rec).
XX
SZ 461 AA; 51.1 kDa (cDNA) (calc.).
XX
SQ MSSPTTSSLDTPLPGNGPPQPGAPSSSPTVKEEGPEPWPGGPDPDVPGTDEASSACSTDW
SQ VIPDPEEEPERKRKKGPAPKMLGHELCRVCGDKASGFHYNVLSCEGCKGFFRRSVVRGGA
SQ RRYACRGGGTCQMDAFMRRKCQQCRLRKCKEAGMREQCVLSEEQIRKKKIRKQQQQESQS
SQ QSQSPVGPQGSSSSASGPGASPGGSEAGSQGSGEGEGVQLTAAQELMIQQLVAAQLQCNK
SQ RSFSDQPKVTPWPLGADPQSRDARQQRFAHFTELAIISVQEIVDFAKQVPGFLQLGREDQ
SQ IALLKASTIEIMLLETARRYNHETECITFLKDFTYSKDDFHRAGLQVEFINPIFEFSRAM
SQ RRLGLDDAEYALLIAINIFSADRPNVQEPGRVEALQQPYVEALLSYTRIKRPQDQLRFPR
SQ MLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDVHE
XX
SC translated from EMBL #U07132
XX
FT 84 157 
SM00399; c4gold.
FT 84 161 
PS51030; NUCLEAR_REC_DBD_2.
FT 85 162 
PF00105; Zinc finger, C4 type (two domains).
FT 273 432 
SM00430; holi.
FT 276 456 
PF00104; Ligand-binding domain of nuclear hormon.
XX
IN T08796 ASC-2; human, Homo sapiens.
IN T09944 DAX1; human, Homo sapiens.
IN T19612 DRIP205; mouse, Mus musculus.
IN T08861 NCOR1-isoform1; human, Homo sapiens.
IN T04687 NCOR1; human, Homo sapiens.
IN T08632 PPARalpha-isoform1; human, Homo sapiens.
IN T09957 PPARbeta; Mammalia.
IN T05351 PPARgamma; human, Homo sapiens.
IN T09964 RXR-alpha; Mammalia.
IN T04689 SMRT; human, Homo sapiens.
IN T04632 SRC-1; human, Homo sapiens.
IN T21552 SRC-1; Mammalia.
IN T04640 SRC3; human, Homo sapiens.
XX
MX M00965 V$DR4_Q2.
MX M00647 V$LXR_Q3.
MX M03795 V$LXR_Q6.
MX M07280 V$NR1NR2_Q3.
XX
BS R09969.
BS R09968.
XX
DR TRANSPATH: MO000082659.
DR EMBL: U07132;
DR EMBL: U09419;
DR UniProtKB: P55055;
XX
RN [1]; RE0013644.
RX PUBMED: 9874807.
RA Janowski B. A., Grogan M. J., Jones S. A., Wisely G. B., Kliewer S. A., Corey E. J., Mangelsdorf D. J.
RT Structural requirements of ligands for the oxysterol liver X receptors LXRalpha and LXRbeta
RL Proc. Natl. Acad. Sci. USA 96:266-271 (1999).
RN [2]; RE0016108.
RX PUBMED: 9013544.
RA Lehmann J. M., Kliewer S. A., Moore L. B., Smith-Oliver T. A., Oliver B. B., Su J. L., Sundseth S. S., Winegar D. A., Blanchard D. E., Spencer T. A., Willson T. M.
RT Activation of the nuclear receptor LXR by oxysterols defines a new hormone response pathway
RL J. Biol. Chem. 272:3137-3140 (1997).
RN [3]; RE0016120.
RX PUBMED: 10683381.
RA Luo Y., Tall A. R.
RT Sterol upregulation of human CETP expression in vitro and in transgenic mice by an LXR element
RL J. Clin. Invest. 105:513-520 (2000).
RN [4]; RE0022921.
RX PUBMED: 12393874.
RA Mo J., Fang S. J., Chen W., Blobe G. C.
RT Regulation of ALK-1 signaling by the nuclear receptor LXRbeta.
RL J. Biol. Chem. 277:50788-50794 (2002).
RN [5]; RE0047844.
RX PUBMED: 15722453.
RA Yue L., Ye F., Gui C., Luo H., Cai J., Shen J., Chen K., Shen X., Jiang H.
RT Ligand-binding regulation of LXR/RXR and LXR/PPAR heterodimerizations: SPR technology-based kinetic analysis correlated with molecular dynamics simulation.
RL Protein Sci. 14:812-822 (2005).
RN [6]; RE0048421.
RX PUBMED: 16219912.
RA Johnson D. R., Li C. W., Chen L. Y., Ghosh J. C., Chen J. D.
RT Regulation and binding of pregnane X receptor by nuclear receptor corepressor silencing mediator of retinoid and thyroid hormone receptors (SMRT).
RL Mol. Pharmacol. 69:99-108 (2006).
RN [7]; RE0048796.
RX PUBMED: 12897148.
RA Wagner B. L., Valledor A. F., Shao G., Daige C. L., Bischoff E. D., Petrowski M., Jepsen K., Baek S. H., Heyman R. A., Rosenfeld M. G., Schulman I. G., Glass C. K.
RT Promoter-specific roles for liver X receptor/corepressor complexes in the regulation of ABCA1 and SREBP1 gene expression.
RL Mol. Cell. Biol. 23:5780-5789 (2003).
RN [8]; RE0050893.
RX PUBMED: 15145977.
RA Nishimaki-Mogami T., Une M., Fujino T., Sato Y., Tamehiro N., Kawahara Y., Shudo K., Inoue K.
RT Identification of intermediates in the bile acid synthetic pathway as ligands for the farnesoid X receptor.
RL J. Lipid Res. 45:1538-1545 (2004).
RN [9]; RE0051017.
RX PUBMED: 16857673.
RA Yang C., McDonald J. G., Patel A., Zhang Y., Umetani M., Xu F., Westover E. J., Covey D. F., Mangelsdorf D. J., Cohen J. C., Hobbs H. H.
RT Sterol intermediates from cholesterol biosynthetic pathway as liver X receptor ligands.
RL J. Biol. Chem. 281:27816-27826 (2006).
RN [10]; RE0051058.
RX PUBMED: 16415294.
RA Schmidt R. J., Ficorilli J. V., Zhang Y., Bramlett K. S., Beyer T. P., Borchert K., Dowless M. S., Houck K. A., Burris T. P., Eacho P. I., Liang G., Guo L. W., Wilson W. K., Michael L. F., Cao G.
RT A 15-ketosterol is a liver X receptor ligand that suppresses sterol-responsive element binding protein-2 activity.
RL J. Lipid Res. 47:1037-1044 (2006).
RN [11]; RE0051131.
RX PUBMED: 16904112.
RA Chen M., Bradley M. N., Beaven S. W., Tontonoz P.
RT Phosphorylation of the liver X receptors.
RL FEBS Lett. 580:4835-4841 (2006).
RN [12]; RE0051160.
RX PUBMED: 12847102.
RA Kaneko E., Matsuda M., Yamada Y., Tachibana Y., Shimomura I., Makishima M.
RT Induction of intestinal ATP-binding cassette transporters by a phytosterol-derived liver X receptor agonist.
RL J. Biol. Chem. 278:36091-36098 (2003).
RN [13]; RE0051194.
RX PUBMED: 16154115.
RA Huang T. H., Razmovski-Naumovski V., Salam N. K., Duke R. K., Tran V. H., Duke C. C., Roufogalis B. D.
RT A novel LXR-alpha activator identified from the natural product Gynostemma pentaphyllum.
RL Biochem. Pharmacol. 70:1298-1308 (2005).
RN [14]; RE0051310.
RX PUBMED: 16354658.
RA Albers M., Blume B., Schlueter T., Wright M. B., Kober I., Kremoser C., Deuschle U., Koegl M.
RT A novel principle for partial agonism of liver X receptor ligands. Competitive recruitment of activators and repressors.
RL J. Biol. Chem. 281:4920-4930 (2006).
RN [15]; RE0051446.
RX PUBMED: 17391100.
RA Jakobsson T., Osman W., Gustafsson J. A., Zilliacus J., Warnmark A.
RT Molecular basis for repression of liver X receptor-mediated gene transcription by receptor-interacting protein 140.
RL Biochem. J. 405:31-39 (2007).
RN [16]; RE0051639.
RX PUBMED: 11068052.
RA Urban F J. r., Cavazos G., Dunbar J., Tan B., Escher P., Tafuri S., Wang M.
RT The important role of residue F268 in ligand binding by LXRbeta.
RL FEBS Lett. 484:159-163 (2000).
XX
//