TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T09944 XX ID T09944 XX DT 23.11.2006 (created); din. DT 05.12.2007 (updated); bch. CO Copyright (C), QIAGEN. XX FA DAX1 XX SY AHCH; DAX-1; NR0B1. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G002819 NR0B1; HGNC: NR0B1. XX CL C0002; CC (rec); 2.1.7.0.1.1. XX SZ 470 AA; 51.7 kDa (cDNA) (calc.). XX SQ MAGENHQWQGSILYNMLMSAKQTRAAPEAPETRLVDQCWGCSCGDEPGVGREGLLGGRNV SQ ALLYRCCFCGKDHPRQGSILYSMLTSAKQTYAAPKAPEATLGPCWGCSCGSDPGVGRAGL SQ PGGRPVALLYRCCFCGEDHPRQGSILYSLLTSSKQTHVAPAAPEARPGGAWWDRSYFAQR SQ PGGKEALPGGRATALLYRCCFCGEDHPQQGSTLYCVPTSTNQAQAAPEERPRAPWWDTSS SQ GALRPVALKSPQVVCEAASAGLLKTLRFVKYLPCFQVLPLDQQLVLVRNCWASLLMLELA SQ QDRLQFETVEVSEPSMLQKILTTRRRETGGNEPLPVPTLQHHLAPPAEARKVPSASQVQA SQ IKCFLSKCWSLNISTKEYAYLKGTVLFNPDVPGLQCVKYIQGLQWGTQQILSEHTRMTHQ SQ GPHDRFIELNSTLFLLRFINANVIAELFFRPIIGTVSMDDMMLEMLCTKI XX SC Swiss-Prot#P51843-1 XX FT 1 204 contains region mainly responsible for RNA-binding [8]. FT 256 440 SM00430; holi. FT 259 465 PF00104; Ligand-binding domain of nuclear hormon. XX IN T02752 LXR-alpha; human, Homo sapiens. IN T09029 LXR-beta; human, Homo sapiens. IN T00696 PR B; human, Homo sapiens. XX MX M01248 V$DAX1_01. XX DR TRANSPATH: MO000093029. DR EMBL: S74720; DR UniProtKB: P51843-1; XX RN [1]; RE0013625. RX PUBMED: 10219237. RA Nuclear Receptors Nomenclature Committee. RT A unified nomenclature system for the nuclear receptor superfamily RL Cell 97:161-163 (1999). RN [2]; RE0013664. RX PUBMED: 7990953. RA Zanaria E., Muscatelli F., Bardoni B., Strom T. M., Guioli S., Guo W., Lalli E., Moser C., Walker A. P., McCabe E. R., et al. RT An unusual member of the nuclear hormone receptor superfamily responsible for X-linked adrenal hypoplasia congenita RL Nature 372:635-641 (1994). RN [3]; RE0013665. RX PUBMED: 7990958. RA Muscatelli F., Strom T. M., Walker A. P., Zanaria E., Recan D., Meindl A., Bardoni B., Guioli S., Zehetner G., Rabl W., et al. RT Mutations in the DAX-1 gene give rise to both X-linked adrenal hypoplasia congenita and hypogonadotropic hypogonadism RL Nature 372:672-676 (1994). RN [4]; RE0013666. RX PUBMED: 9003500. RA Schwartz M., Blichfeldt S., Muller J. RT X-linked adrenal hypoplasia in a large Greenlandic family. Detection of a missense mutation (N4401) in the DAX-1 gene; implication for genetic counselling and carrier diagnosis RL Hum. Genet. 99:83-87 (1997). RN [5]; RE0016767. RX PUBMED: 8754790. RA Majdic G., Saunders P. T. RT Differential patterns of expression of DAX-1 and steroidogenic factor-1 (SF-1) in the fetal rat testis RL Endocrinology 137:3586-3589 (1996). RN [6]; RE0016769. RX PUBMED: 9566914. RA Crawford P. A., Dorn C., Sadovsky Y., Milbrandt J. RT Nuclear receptor DAX-1 recruits nuclear receptor corepressor N-CoR to steroidogenic factor 1 RL Mol. Cell. Biol. 18:2949-2956 (1998). RN [7]; RE0016772. RX PUBMED: 11301600. RA Goodfellow P. N., Camerino G. RT DAX-1, an "antitestis" gene RL EXS 91:57-69 (2001). RN [8]; RE0016774. RX PUBMED: 10848616. RA Lalli E., Ohe K., Hindelang C., Sassone-Corsi P. RT Orphan receptor DAX-1 is a shuttling RNA binding protein associated with polyribosomes via mRNA RL Mol. Cell. Biol. 20:4910-4921 (2000). RN [9]; RE0030408. RX PUBMED: 12771131. RA Agoulnik I. U., Krause W. C., Bingman W. E. 3rd, Rahman H. T., Amrikachi M., Ayala G. E., Weigel N. L. RT Repressors of androgen and progesterone receptor action. RL J. Biol. Chem. 278:31136-48 (2003). RN [10]; RE0051310. RX PUBMED: 16354658. RA Albers M., Blume B., Schlueter T., Wright M. B., Kober I., Kremoser C., Deuschle U., Koegl M. RT A novel principle for partial agonism of liver X receptor ligands. Competitive recruitment of activators and repressors. RL J. Biol. Chem. 281:4920-4930 (2006). XX //