TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T08699 XX ID T08699 XX DT 13.03.2006 (created); jag. DT 13.11.2006 (updated); kau. CO Copyright (C), QIAGEN. XX FA XBP-1U XX SY Tax-responsive element-binding protein 5; TREB5; X box-binding protein 1; X-box binding protein 1; XBP-1; XBP-1 unspliced; XBP1; XBP2. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G006882 XBP1; HGNC: XBP1. XX CL C0008; bZIP; 1.1.5.0.1.1. XX SZ 261 AA; 28.7 kDa (cDNA) (calc.). XX SQ MVVVAAAPNPADGTPKVLLLSGQPASAAGAPAGQALPLMVPAQRGASPEAASGGLPQARK SQ RQRLTHLSPEEKALRRKLKNRVAAQTARDRKKARMSELEQQVVDLEEENQKLLLENQLLR SQ EKTHGLVVENQELRQRLGMDALVAEEEAEAKGNEVRPVAGSAESAALRLRAPLQQVQAQL SQ SPLQNISPWILAVLTLQIQSLISCWAFWTTWTQSCSSNALPQSLPAWRSSQRSTQKDPVP SQ YQPPFLCQWGRHQPSWKPLMN XX SC translated from EMBL #AB076383 XX FT 68 122 PF07716; Basic region leucine zipper. FT 68 132 SM00338; brlzneu. FT 70 133 PS50217; BZIP. FT 75 133 bZIP domain [3]. FT 165 261 unique to XBP-1U [3]. XX FF suggested to function as a co-regulator to enhance ERa transcriptional activity in a ligand-independent manner [1]; FF does not bind to ER stress response element by itself [3]; XX IN T09623 ATF-6; human, Homo sapiens. IN T00261 ER-alpha; human, Homo sapiens. IN T08699 XBP-1U; human, Homo sapiens. IN T27866 Zhangfei; human, Homo sapiens. XX MX M00538 V$HTF_01. XX DR TRANSPATH: MO000079050. DR EMBL: AB076383; AB076383. DR UniProtKB: P17861-1; XX RN [1]; RE0047405. RX PUBMED: 12954762. RA Ding L., Yan J., Zhu J., Zhong H., Lu Q., Wang Z., Huang C., Ye Q. RT Ligand-independent activation of estrogen receptor alpha by XBP-1. RL Nucleic Acids Res. 31:5266-5274 (2003). RN [2]; RE0048287. RX PUBMED: 12805554. RA Newman J. R., Keating A. E. RT Comprehensive identification of human bZIP interactions with coiled-coil arrays. RL Science 300:2097-2101 (2003). RN [3]; RE0028961. RX PUBMED: 11779464. RA Yoshida H., Matsui T., Yamamoto A., Okada T., Mori K. RT XBP1 mRNA is induced by ATF6 and spliced by IRE1 in response to ER stress to produce a highly active transcription factor. RL Cell 107:881-91 (2001). XX //