TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T08800 XX ID T08800 XX DT 04.04.2006 (created); sla. DT 28.05.2014 (updated); yre. CO Copyright (C), QIAGEN. XX FA nanog-isoform1 XX SY 2410002E02Rik; Embryonic stem cell specific homeobox protein; ENK; ES cells cDNA, RIKEN full-length enriched library, clone:2410002E02 product:Nanog homeobox, full insert sequence; Nanog; Nanog homeobox. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G031512 Nanog. XX CL C0006; homeo; 3.1.2.12.1.1. XX SZ 305 AA; 34.2 kDa (cDNA) (calc.). XX SQ MSVGLPGPHSLPSSEEASNSGNASSMPAVFHPENYSCLQGSATEMLCTEAASPRPSSEDL SQ PLQGSPDSSTSPKQKLSSPEADKGPEEEENKVLARKQKMRTVFSQAQLCALKDRFQKQKY SQ LSLQQMQELSSILNLSYKQVKTWFQNQRVKCKRWQKNQWLKTSNGLIQKGSAPVEYPSIH SQ CSYPQGYLVNASGSLSMWGSQTWTNPTWSSQTWTNPTWNNQTWTNPTWSSQAWTAQSWNG SQ QPWNAAPLHNFGEDFLQPYVQLQQNFSASDLEVNLEATRESHAHFSTPQALELFLNYSVT SQ PPGEI XX SC translated from EMBL:AB093574 XX FT 105 119 Helix 1 [4]. FT 123 131 Helix 2 [4]. FT 137 153 Helix 3 [4]. XX SF homeodomain-containing protein [1]; SF sequence is 25 bp longer at the N-terminus than nanog1a; XX CP expressed specifically in pluripotential embryonic stem cells [5]. CN brain, heart, kidney, testis, spleen, muscle, lung, stomach, ovary, thymus, liver, skin [6]; adipose, kidney, liver, heart, spleen, brain, bone marrow, tongue, eye, oviduct, thymus, skeletal muscle, skin, ovary, seminiferous vesicle, lung [4]. XX FF critical factor underlying pluripotency in inner cell mass (ICM) and embryonic stem (ES) cells [6]; FF nanog has the ability to maintain ES self-renewal without LIF [6]; XX IN T11261 c-Rel; Mammalia. IN T15122 ERR2; mouse, Mus musculus. IN T08800 nanog-isoform1; mouse, Mus musculus. IN T10397 RelA-p65; Mammalia. IN T27517 RelB; Mammalia. IN T15304 Sall1; mouse, Mus musculus. IN T16034 Sox-2; mouse, Mus musculus. XX MX M01123 V$NANOG_01. MX M01247 V$NANOG_02. XX DR TRANSPATH: MO000079788. DR EMBL: AB093574; AB093574. DR EMBL: AY278951; AY278951. DR UniProtKB: Q80Z64-1; XX RN [1]; RE0047531. RX PUBMED: 16518401. RA Loh Y. H., Wu Q., Chew J. L., Vega V. B., Zhang W., Chen X., Bourque G., George J., Leong B., Liu J., Wong K. Y., Sung K. W., Lee C. W., Zhao X. D., Chiu K. P., Lipovich L., Kuznetsov V. A., Robson P., Stanton L. W., Wei C. L., Ruan Y., Lim B., Ng H. H. RT The Oct4 and Nanog transcription network regulates pluripotency in mouse embryonic stem cells. RL Nat. Genet. 38:431-440 (2006). RN [2]; RE0064775. RX PUBMED: 18223644. RA Torres J., Watt F. M. RT Nanog maintains pluripotency of mouse embryonic stem cells by inhibiting NFkappaB and cooperating with Stat3. RL Nat. Cell Biol. 10:194-201 (2008). RN [3]; RE0066220. RX PUBMED: 18957414. RA Zhang X., Zhang J., Wang T., Esteban M. A., Pei D. RT Esrrb activates Oct4 transcription and sustains self-renewal and pluripotency in embryonic stem cells. RL J. Biol. Chem. 283:35825-35833 (2008). RN [4]; RE0047645. RX PUBMED: 12787505. RA Chambers I., Colby D., Robertson M., Nichols J., Lee S., Tweedie S., Smith A. RT Functional expression cloning of Nanog, a pluripotency sustaining factor in embryonic stem cells. RL Cell 113:643-655 (2003). RN [5]; RE0047634. RX PUBMED: 15743839. RA Kuroda T., Tada M., Kubota H., Kimura H., Hatano S. Y., Suemori H., Nakatsuji N., Tada T. RT Octamer and Sox elements are required for transcriptional cis regulation of Nanog gene expression. RL Mol. Cell. Biol. 25:2475-2485 (2005). RN [6]; RE0047637. RX PUBMED: 12787504. RA Mitsui K., Tokuzawa Y., Itoh H., Segawa K., Murakami M., Takahashi K., Maruyama M., Maeda M., Yamanaka S. RT The homeoprotein Nanog is required for maintenance of pluripotency in mouse epiblast and ES cells. RL Cell 113:631-642 (2003). XX //