TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T09000 XX ID T09000 XX DT 06.06.2006 (created); kau. DT 10.10.2011 (updated); sla. CO Copyright (C), QIAGEN. XX FA Fli-1-isoform1 XX SY Erg-B; friend leukemia integration site 1. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G007339 FLI1; HGNC: FLI1. XX CL C0016; ETS; 3.5.2.1.5.1. XX SZ 452 AA; 51.0 kDa (cDNA) (calc.), 55 kDa (SDS) [5] XX SQ MDGTIKEALSVVSDDQSLFDSAYGAAAHLPKADMTASGSPDYGQPHKINPLPPQQEWINQ SQ PVRVNVKREYDHMNGSRESPVDCSVSKCSKLVGGGESNPMNYNSYMDEKNGPPPPNMTTN SQ ERRVIVPADPTLWTQEHVRQWLEWAIKEYSLMEIDTSFFQNMDGKELCKMNKEDFLRATT SQ LYNTEVLLSHLSYLRESSLLAYNTTSHTDQSSRLSVKEDPSYDSVRRGAWGNNMNSGLNK SQ SPPLGGAQTISKNTEQRPQPDPYQILGPTSSRLANPGSGQIQLWQFLLELLSDSANASCI SQ TWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKF SQ DFHGIAQALQPHPTESSMYKYPSDISYMPSYHAHQQKVNFVPPHPSSMPVTSSSFFGAAS SQ QYWTSPTGGIYPNPNVPRHPNTHVPSHLGSYY XX SC Swiss-Prot#Q01543-1 XX FT 106 271 ATA (amino-terminal transcriptional activation) domain [6]. FT 114 198 PF02198; Sterile alpha motif (SAM)/Pointed domain. FT 114 198 SM00251; SAM2_3. FT 129 196 POINTED domain of homology [1]. FT 280 363 PF00178; Ets-domain. FT 280 365 SM00413; etsneu2. FT 281 361 PS50061; ETS_DOMAIN_3. FT 283 351 PS50140; HSF_ETS. FT 402 452 CTA (carboxy-terminal transcriptional activation) domain [6]. XX IN T08291 GATA-1-isoform1; mouse, Mus musculus. IN T00306 GATA-1; human, Homo sapiens. XX MX M08881 V$ETSLIKE_Q4. MX M00771 V$ETS_Q4. MX M00971 V$ETS_Q6. MX M02073 V$FLI1_02. MX M07382 V$FLI1_Q5. MX M01208 V$FLI1_Q6. XX BS R00460. BS R25722. BS R29136. BS R29140. BS R29146. XX DR TRANSPATH: MO000082496. DR EMBL: M93255; DR EMBL: M98833; DR EMBL: S45205; DR EMBL: X67001; DR UniProtKB: Q01543-1; DR PDB: 1FLI. XX RN [1]; RE0005316. RX PUBMED: 8223245. RA Klaembt C. RT The Drosophila gene pointed encodes two ETS-like proteins which are involved in the development of the midline glial cells RL Development 117:163-176 (1993). RN [2]; RE0005341. RX PUBMED: 1445800. RA Watson D. K., Smyth F. E., Thompson D. M., Cheng J. Q., Testa J. R., Papas T. S., Seth A. RT The ERGB/Fli-1 gene: Isolation and characterization of a new member of the family of human ETS transcription factors RL Cell Growth Differ. 3:705-713 (1992). RN [3]; RE0005342. RX PUBMED: 1522903. RA Delattre O., Zucman J., Plougastel B., Desmaze C., Melot T., Peter M., Kovar H., Joubert I., de Jong P., Rouleau G. RT Gene fusion with an ETS DNA-binding domain caused by chromosome translocation in human tumours RL Nature 359:162-165 (1992). RN [4]; RE0005344. RX PUBMED: 8439553. RA Hromas R. A., Mau W., Denny C., Raskind W., Moore J., Maki R. A., Beck E., Klemsz M. J. RT Human FLI-1 localizes to chromosome 11Q24 and has an aberrant transcript in neureopethelioma RL Biochim. Biophys. Acta 1172:155-158 (1993). RN [5]; RE0005345. RX PUBMED: 1394211. RA Prasad D. D. K., Rao V. N., Reddy E. S. P. RT Structure and expression of human Fli-1 gene RL Cancer Res. 52:5833-5837 (1992). RN [6]; RE0005346. RX PUBMED: 8336942. RA Rao V. N., Ohno T., Prasad D. D. K., Battacharya G., Reddy E. S. P. RT Analysis of the DNA binding and transcriptional activation functions of human Fli-1 protein RL Oncogene 8:2167-2173 (1993). RN [7]; RE0005347. RX PUBMED: 7503813. RA Ohno T., Rao V. N., Reddy E. S. P. RT EWS/Fli-1 chimeric protein is a transcriptional activator RL Cancer Res. 53:5859-5863 (1993). RN [8]; RE0005348. RX PUBMED: 8516324. RA May W. A., Gishizky M. L., Lessnick S. L., Lunsford L. B., Lewis B. C., Delattre O., Zucman J., Thomas G., Denny X. C. T. RT Ewing sarcoma 11;22 translocation produces a chimeric transcription factor that requires the DNA-binding domain encoded by FLI1 for transformation RL Proc. Natl. Acad. Sci. USA 90:5752-5756 (1993). RN [9]; RE0005349. RX PUBMED: 7972119. RA Liang H., Olejniczak E. T., Mao X., Nettesheim D. G., Yu L., Thompson C. B., Fesik S. W. RT The secondary structure of the ets domain of human Fli-1 resembles that of the helix-turn-helix DNA-binding motif of the Escherichia coli catabolite gene activator protein RL Proc. Natl. Acad. Sci. USA 91:11655-11659 (1994). RN [10]; RE0015489. RX PUBMED: 8604338. RA Magnaghi-Jaulin L., Masutani H., Robin P., Lipinski M., Harel-Bellan A. RT SRE elements are binding sites for the fusion protein EWS-FLI-1 RL Nucleic Acids Res. 24:1052-1058 (1996). RN [11]; RE0015517. RX PUBMED: 8764983. RA Magnaghi-Jaulin L., Masutani H., Lipinski M., Harel-Bellan A. RT Analysis of SRF, SAP-1 and ELK-1 transcripts and proteins in human cell lines RL FEBS Lett. 391:247-251 (1996). RN [12]; RE0037433. RX PUBMED: 12724402. RA Eisbacher M., Holmes M. L., Newton A., Hogg P. J., Khachigian L. M., Crossley M., Chong B. H. RT Protein-protein interaction between Fli-1 and GATA-1 mediates synergistic expression of megakaryocyte-specific genes through cooperative DNA binding RL Mol. Cell. Biol. 23:3427-41 (2003). RN [13]; RE0049074. RX PUBMED: 16148010. RA van den Akker E., Ano S., Shih H. M., Wang L. C., Pironin M., Palvimo J. J., Kotaja N., Kirsh O., Dejean A., Ghysdael J. RT FLI-1 functionally interacts with PIASxalpha, a member of the PIAS E3 SUMO ligase family. RL J. Biol. Chem. 280:38035-38046 (2005). RN [14]; RE0049075. RX PUBMED: 15798196. RA Hu W., Philips A. S., Kwok J. C., Eisbacher M., Chong B. H. RT Identification of nuclear import and export signals within Fli-1: roles of the nuclear import signals in Fli-1-dependent activation of megakaryocyte-specific promoters. RL Mol. Cell. Biol. 25:3087-3108 (2005). XX //