AC T09007
XX
ID T09007
XX
DT 06.06.2006 (created); jag.
DT 14.11.2013 (updated); prb.
CO Copyright (C), QIAGEN.
XX
FA c-Myc
XX
SY c-Myc.
XX
OS mouse, Mus musculus
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae
XX
GE G000489 Myc.
XX
CL C0012; bHLH-ZIP; 1.2.6.5.1.1.
XX
SZ 439 AA; 49.0 kDa (cDNA) (calc.), 64, 67 kDa (SDS)
XX
SQ MPLNVNFTNRNYDLDYDSVQPYFICDEEENFYHQQQQSELQPPAPSEDIWKKFELLPTPP
SQ LSPSRRSGLCSPSYVAVATSFSPREDDDGGGGNFSTADQLEMMTELLGGDMVNQSFICDP
SQ DDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSTSLSPARGHSVCSTSSLYLQ
SQ DLTAAASECIDPSVVFPYPLNDSSSPKSCTSSDSTAFSPSSDSLLSSESSPRASPEPLVL
SQ HEETPPTTSSDSEEEQEDEEEIDVVSVEKRQTPAKRSESGSSPSRGHSKPPHSPLVLKRC
SQ HVSTHQHNYAAPPSTRKDYPAAKRAKLDSGRVLKQISNNRKCSSPRSSDTEENDKRRTHN
SQ VLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSIQADEHKLTSEKDLL
SQ RKRREQLKHKLEQLRNSGA
XX
SC translated from EMBL #X01023
XX
FT 1 345 
PF01056; Myc amino-terminal region.
FT 354 407 
PS50888; HLH.
FT 355 407 
PF00010; Helix-loop-helix DNA-binding domain.
FT 360 412 
SM00353; finulus.
FT 408 439 
PF02344; Myc leucine zipper domain.
XX
IN T09303 BAF47-isoformA; human, Homo sapiens.
IN T00489 Max-isoform2; human, Homo sapiens.
IN T21984 p300; human, Homo sapiens.
IN T06377 PML; human, Homo sapiens.
XX
MX M01145 V$CMYC_01.
MX M01154 V$CMYC_02.
MX M07601 V$CMYC_Q3.
MX M03867 V$CMYC_Q6_01.
MX M01034 V$EBOX_Q6_01.
MX M00118 V$MYCMAX_01.
MX M00123 V$MYCMAX_02.
MX M00615 V$MYCMAX_03.
MX M00322 V$MYCMAX_B.
MX M02250 V$MYC_01.
MX M00799 V$MYC_Q2.
XX
BS R21824.
BS R21825.
BS R21826.
BS R21827.
BS R21828.
BS R21829.
BS R21830.
BS R21831.
BS R21832.
BS R21833.
BS R21834.
BS R21835.
BS R21836.
BS R21837.
BS R21838.
BS R21839.
BS R21840.
BS R21841.
BS R21842.
BS R21843.
BS R21844.
BS R22127.
BS R21862.
BS R21863.
BS R21864.
BS R21865.
BS R21866.
BS R21867.
BS R21868.
BS R21869.
BS R21870.
BS R21871.
BS R21872.
BS R21873.
BS R21874.
BS R21875.
BS R21876.
BS R21877.
BS R21878.
BS R21879.
BS R22079.
BS R22080.
BS R22081.
BS R22082.
BS R22083.
BS R22084.
BS R22085.
BS R22086.
BS R39509.
XX
DR TRANSPATH: MO000082521.
DR EMBL: BC006728;
DR EMBL: X01023;
DR UniProtKB: P01108;
XX
RN [1]; RE0000173.
RX PUBMED: 1840505.
RA Prendergast G. C., Lawe D., Ziff E. B.
RT Association of Myn, the murine homolog of Max, with c-Myc stimulates methylation-sensitive DNA binding and ras cotransformation
RL Cell 65:395-407 (1991).
RN [2]; RE0000428.
RX PUBMED: 2686984.
RA Ariga H., Imamura Y., Iguchi-Ariga S. M. M.
RT DNA replication origin and transcriptional enhancer in c-myc gene share the c-myc protein binding sequences
RL EMBO J. 8:4273-4279 (1989).
RN [3]; RE0001483.
RX PUBMED: 1990293.
RA Dang C. V., Barrett J., Villa-Garcia M., Resar L. M. S., Kato G. J., Fearon E. R.
RT Intracellular leucine zipper interactions suggest c-Myc hetero-oligomerization
RL Mol. Cell. Biol. 11:954-962 (1991).
RN [4]; RE0002652.
RX PUBMED: 2251503.
RA Blackwell T. K., Kretzner L., Blackwood E. M., Eisenman R. N., Weintraub H.
RT Sequence-specific DNA binding by the c-Myc protein
RL Science 250:1149-1151 (1990).
RN [5]; RE0002653.
RX PUBMED: 2006410.
RA Blackwood E. M., Eisenman R. N.
RT Max: a helix-loop-helix zipper protein that forms a sequence-specific DNA-binding complex with Myc
RL Science 251:1211-1217 (1991).
RN [6]; RE0003342.
RX PUBMED: 1549358.
RA Moberg K. H., Logan T. J., Tyndall W. A., Hall D. J.
RT Three distinct elements within the murine c-myc promoter are required for transcription
RL Oncogene 7:411-421 (1992).
RN [7]; RE0003349.
RX PUBMED: 3024965.
RA Nepveu A., Marcu K. B.
RT Intragenic pausing and anti-sense transcription within the murine c-myc locus
RL EMBO J. 5:2859-2865 (1986).
RN [8]; RE0005851.
RX PUBMED: 7667316.
RA Chin L., Schreiber-Agus N., Pellicer I., Chen K., Lee H.-W., Dudast M., Cordon-Cardo C., DePinho R. A.
RT Contrasting roles for Myc and Mad proteins in cellular growth and differentiation
RL Proc. Natl. Acad. Sci. USA 92:8488-8492 (1995).
RN [9]; RE0006781.
RX PUBMED: 7882978.
RA Morgenbesser S. D., Schreiber-Agus N., Bidder M., Mahon K. A., Overbeek P. A., Horner J., DePinho R. A.
RT Contrasting roles for c-Myc and L-Myc in the regulation of cellular growth and differentiation in vivo
RL EMBO J. 14:743-756 (1995).
RN [10]; RE0014513.
RX PUBMED: 10557294.
RA Iritani B. M., Eisenman R. N.
RT c-Myc enhances protein synthesis and cell size during B lymphocyte development
RL Proc. Natl. Acad. Sci. USA 96:13180-13185 (1999).
RN [11]; RE0014549.
RX PUBMED: 6462227.
RA Stanton L. W., Fahrlander P. D., Tesser P. M., Marcu K. B.
RT Nucleotide sequence comparison of normal and translocated murine c-myc genes
RL Nature 310:423-425 (1984).
RN [12]; RE0014569.
RX PUBMED: 7991585.
RA Mueller J. R., Potter M., Janz S.
RT Differences in the molecular structure of c-myc-activating recombinations in murine plasmacytomas and precursor cells
RL Proc. Natl. Acad. Sci. USA 91:12066-12070 (1994).
RN [13]; RE0014588.
RX PUBMED: 6321164.
RA Bernard O., Cory S., Gerondakis S., Webb E., Adams J. M.
RT Sequence of the murine and human cellular myc oncogenes and two modes of myc transcription resulting from chromosome translocation in B lymphoid tumours
RL EMBO J. 2:2375-2383 (1983).
RN [14]; RE0046069.
RX PUBMED: 10319872.
RA Cheng S. W., Davies K. P., Yung E., Beltran R. J., Yu J., Kalpana G. V.
RT c-MYC interacts with INI1/hSNF5 and requires the SWI/SNF complex for transactivation function
RL Nat. Genet. 22:102-5 (1999).
RN [15]; RE0047829.
RX PUBMED: 16287840.
RA Faiola F., Liu X., Lo S., Pan S., Zhang K., Lymar E., Farina A., Martinez E.
RT Dual regulation of c-Myc by p300 via acetylation-dependent control of Myc protein turnover and coactivation of Myc-induced transcription.
RL Mol. Cell. Biol. 25:10220-10234 (2005).
RN [16]; RE0048254.
RX PUBMED: 14563837.
RA Gregory M. A., Qi Y., Hann S. R.
RT Phosphorylation by glycogen synthase kinase-3 controls c-myc proteolysis and subnuclear localization.
RL J. Biol. Chem. 278:51606-51612 (2003).
RN [17]; RE0048255.
RX PUBMED: 8035827.
RA Lutterbach B., Hann S. R.
RT Hierarchical phosphorylation at N-terminal transformation-sensitive sites in c-Myc protein is regulated by mitogens and in mitosis.
RL Mol. Cell. Biol. 14:5510-5522 (1994).
RN [18]; RE0048481.
RX PUBMED: 15735755.
RA Cairo S., De Falco F., Pizzo M., Salomoni P., Pandolfi P. P., Meroni G.
RT PML interacts with Myc, and Myc target gene expression is altered in PML-null fibroblasts.
RL Oncogene 24:2195-2203 (2005).
RN [19]; RE0049739.
RX PUBMED: 17217336.
RA Faiola F., Wu Y. T., Pan S., Zhang K., Farina A., Martinez E.
RT Max is acetylated by p300 at several nuclear localization residues.
RL Biochem. J. 403:397-407 (2007).
XX
//