TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T09098 XX ID T09098 XX DT 20.06.2006 (created); jag. DT 28.10.2014 (updated); mkl. CO Copyright (C), QIAGEN. XX FA SREBP-2-isoform1 XX SY SREBP-2 mature form; SREBP2-P; SREBP2-precursor form; Sterol Regulatory Element Binding Protein 2. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G002349 SREBF2; HGNC: SREBF2. XX CL C0012; bHLH-ZIP. XX SZ 1141 AA; 123.7 kDa (cDNA) (calc.), 120 kDa (SDS) XX SQ MDDSGELGGLETMETLTELGDELTLGDIDEMLQFVSNQVGEFPDLFSEQLCSSFPGSGGS SQ GSSSGSSGSSSSSSNGRGSSSGAVDPSVQRSFTQVTLPSFSPSAASPQAPTLQVKVSPTS SQ VPTTPRATPILQPRPQPQPQPQTQLQQQTVMITPTFSTTPQTRIIQQPLIYQNAATSFQV SQ LQPQVQSLVTSSQVQPVTIQQQVQTVQAQRVLTQTANGTLQTLAPATVQTVAAPQVQQVP SQ VLVQPQIIKTDSLVLTTLKTDGSPVMAAVQNPALTALTTPIQTAALQVPTLVGSSGTILT SQ TMPVMMGQEKVPIKQVPGGVKQLEPPKEGERRTTHNIIEKRYRSSINDKIIELKDLVMGT SQ DAKMHKSGVLRKAIDYIKYLQQVNHKLRQENMVLKLANQKNKLLKGIDLGSLVDNEVDLK SQ IEDFNQNVLLMSPPASDSGSQAGFSPYSIDSEPGSPLLDDAKVKDEPDSPPVALGMVDRS SQ RILLCVLTFLCLSFNPLTSLLQWGGAHDSDQHPHSGSGRSVLSFESGSGGWFDWMMPTLL SQ LWLVNGVIVLSVFVKLLVHGEPVIRPHSRSSVTFWRHRKQADLDLARGDFAAAAGNLQTC SQ LAVLGRALPTSRLDLACSLSWNVIRYSLQKLRLVRWLLKKVFQCRRATPATEAGFEDEAK SQ TSARDAALAYHRLHQLHITGKLPAGSACSDVHMALCAVNLAECAEEKIPPSTLVEIHLTA SQ AMGLKTRCGGKLGFLASYFLSRAQSLCGPEHSAVPDSLRWLCHPLGQKFFMERSWSVKSA SQ AKESLYCAQRNPADPIAQVHQAFCKNLLERAIESLVKPQAKKKAGDQEEESCEFSSALEY SQ LKLLHSFVDSVGVMSPPLSRSSVLKSALGPDIICRWWTSAITVAISWLQGDDAAVRSHFT SQ KVERIPKALEVTESPLVKAIFHACRAMHASLPGKADGQQSSFCHCERASGHLWSSLNVSG SQ ATSDPALNHVVQLLTCDLLLSLRTALWQKQASASQAVGETYHASGAELAGFQRDLGSLRR SQ LAHSFRPAYRKVFLHEATVRLMAGASPTRTHQLLEHSLRRRTTQSTKHGEVDAWPGQRER SQ ATAILLACRHLPLSFLSSPGQRAVLLAEAARTLEKVGDRRSCNDCQQMIVKLGGGTAIAA SQ S XX SC Swiss-Prot#Q12772 XX FT 120 403 PF00478; IMP dehydrogenase / GMP reductase domain. FT 330 381 PS50888; HLH. FT 331 381 PF00010; Helix-loop-helix DNA-binding domain. FT 336 386 SM00353; finulus. FT 468 469 SCA cleavage site [2]. XX SF exists as a stable dimer in solution [17]; XX FF key regulator of cellular cholesterol uptake [15]; FF binds directly to importin beta via the HLH-Zip domain, which mediates the transport into the nucleus [16]; FF is produced as a large precursor molecule attached to the endoplasmic reticulum membrane [16]; XX IN T14269 MIZF; human, Homo sapiens. IN T28267 PGC-1; Mammalia. IN T05140 trrap; human, Homo sapiens. XX MX M01177 V$SREBP2_Q6. MX M03852 V$SREBP2_Q6_01. MX M00776 V$SREBP_Q3. MX M01168 V$SREBP_Q6. XX BS R22195. BS R20861. BS R31581. BS R19290. BS R04416. BS R04417. BS R22190. BS R31016. BS R31642. BS R21206. BS R30370. BS R31277. BS R19361. BS R28174. BS R31229. BS R20657. BS R20660. BS R20662. BS R20665. BS R20666. BS R28173. BS R19472. BS R21130. BS R30560. BS R31524. BS R31089. BS R19307. BS R28444. BS R19305. BS R19288. XX DR TRANSPATH: MO000083304. DR EMBL: U02031; DR UniProtKB: Q12772; XX RN [1]; RE0003436. RX PUBMED: 7903453. RA Hua X., Yokoyama C., Wu J., Briggs M. R., Brown M. S., Goldstein J., Wang X. RT SREBP-2, a second basic-helix-loop-helix-leucine zipper protein that stimulates transcription by binding to a sterol regulatory element RL Proc. Natl. Acad. Sci. USA 90:11603-11607 (1993). RN [2]; RE0005535. RX PUBMED: 7629113. RA Wang X., Pai J., Wiedenfeld E. A., Medina J. C., Slaughter C. A., Goldstein J. L., Brown M. S. RT Purification of an interleukin-1 beta converting enzyme-related cysteine protease that cleaves sterol regulatory element-binding proteins between the leucine zipper and transmembran domains RL J. Biol. Chem. 270:18044-18050 (1995). RN [3]; RE0005825. RX PUBMED: 7493979. RA Hua X., Sakai J., Ho Y. K., Goldstein J. L., Brown M. S. RT Hairpin orientation of sterol regulatory element-binding protein-2 in cell membrans as determined by protease protection RL J. Biol. Chem. 270:29422-29427 (1995). RN [4]; RE0012693. RX PUBMED: 8674110. RA Sakai J., Duncan E. A., Rawson R. B., Hua X., Brown M. S., Goldstein J. L. RT Sterol-regulated release of SREBP-2 from cell membranes requires two sequential cleavages, one within a transmembrane segment RL Cell 85:1037-1046 (1996). RN [5]; RE0029395. RX PUBMED: 10627507. RA Kotzka J., Muller-Wieland D., Roth G., Kremer L., Munck M., Schurmann S., Knebel B., Krone W. RT Sterol regulatory element binding proteins (SREBP)-1a and SREBP-2 are linked to the MAP-kinase cascade. RL J. Lipid Res. 41:99-108 (2000). RN [6]; RE0044593. RX PUBMED: 12202038. RA Yang T., Espenshade P. J., Wright M. E., Yabe D., Gong Y., Aebersold R., Goldstein J. L., Brown M. S. RT Crucial step in cholesterol homeostasis: sterols promote binding of SCAP to INSIG-1, a membrane protein that facilitates retention of SREBPs in ER RL Cell 110:489-500 (2002). RN [7]; RE0047955. RX PUBMED: 14988395. RA Kotzka J., Lehr S., Roth G., Avci H., Knebel B., Muller-Wieland D. RT Insulin-activated Erk-mitogen-activated protein kinases phosphorylate sterol regulatory element-binding Protein-2 at serine residues 432 and 455 in vivo. RL J. Biol. Chem. 279:22404-22411 (2004). RN [8]; RE0051009. RX PUBMED: 12242332. RA Yabe D., Brown M. S., Goldstein J. L. RT Insig-2, a second endoplasmic reticulum protein that binds SCAP and blocks export of sterol regulatory element-binding proteins. RL Proc. Natl. Acad. Sci. USA 99:12753-12758 (2002). RN [9]; RE0052290. RX PUBMED: 9651382. RA Duncan E. A., Dave U. P., Sakai J., Goldstein J. L., Brown M. S. RT Second-site cleavage in sterol regulatory element-binding protein occurs at transmembrane junction as determined by cysteine panning. RL J. Biol. Chem. 273:17801-17809 (1998). RN [10]; RE0052304. RX PUBMED: 9139737. RA Duncan E. A., Brown M. S., Goldstein J. L., Sakai J. RT Cleavage site for sterol-regulated protease localized to a leu-Ser bond in the lumenal loop of sterol regulatory element-binding protein-2. RL J. Biol. Chem. 272:12778-12785 (1997). RN [11]; RE0052412. RX PUBMED: 9809072. RA Sakai J., Rawson R. B., Espenshade P. J., Cheng D., Seegmiller A. C., Goldstein J. L., Brown M. S. RT Molecular identification of the sterol-regulated luminal protease that cleaves SREBPs and controls lipid composition of animal cells. RL Mol. Cell 2:505-514 (1998). RN [12]; RE0052431. RX PUBMED: 16571675. RA Du X., Kristiana I., Wong J., Brown A. J. RT Involvement of Akt in ER-to-Golgi transport of SCAP/SREBP: a link between a key cell proliferative pathway and membrane synthesis. RL Mol. Biol. Cell 17:2735-2745 (2006). RN [13]; RE0066027. RX PUBMED: 19158095. RA Yellaturu C. R., Deng X., Cagen L. M., Wilcox H. G., Mansbach CM 2. n. d., Siddiqi S. A., Park E. A., Raghow R., Elam M. B. RT Insulin enhances post-translational processing of nascent SREBP-1c by promoting its phosphorylation and association with COPII vesicles. RL J. Biol. Chem. 284:7518-7532 (2009). RN [14]; RE0066824. RX PUBMED: 20450493. RA Ishimoto K., Tachibana K., Hanano I., Yamasaki D., Nakamura H., Kawai M., Urano Y., Tanaka T., Hamakubo T., Sakai J., Kodama T., Doi T. RT Sterol regulatory element-binding protein 2 and nuclear factor Y controls human farnesyl diphosphate synthase expression and affects cell proliferation in hepatoblastoma cells. RL Biochem. J. 429:347-357 (2010). RN [15]; RE0047920. RX PUBMED: 15486308. RA Treguier M., Doucet C., Moreau M., Dachet C., Thillet J., Chapman M. J., Huby T. RT Transcription factor sterol regulatory element binding protein 2 regulates scavenger receptor Cla-1 gene expression. RL Arterioscler. Thromb. Vasc. Biol. 24:2358-2364 (2004). RN [16]; RE0047931. RX PUBMED: 10397761. RA Nagoshi E., Imamoto N., Sato R., Yoneda Y. RT Nuclear import of sterol regulatory element-binding protein-2, a basic helix-loop-helix-leucine zipper (bHLH-Zip)-containing transcription factor, occurs through the direct interaction of importin beta with HLH-Zip. RL Mol. Biol. Cell 10:2221-2233 (1999). RN [17]; RE0047954. RX PUBMED: 11283257. RA Nagoshi E., Yoneda Y. RT Dimerization of sterol regulatory element-binding protein 2 via the helix-loop-helix-leucine zipper domain is a prerequisite for its nuclear localization mediated by importin beta. RL Mol. Cell. Biol. 21:2779-2789 (2001). XX //