TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T09106 XX ID T09106 XX DT 22.06.2006 (created); jma. DT 04.04.2014 (updated); spk. CO Copyright (C), QIAGEN. XX FA RelA-p65 XX SY NF-kappaB (p65); Rel-A; RELA; v-rel reticuloendotheliosis viral oncogene homolog A (avian). XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G009183 Rela. XX CL C0020; Rel; 6.1.1.2.1.1. XX SZ 549 AA; 60.2 kDa (cDNA) (calc.), 65 kDa (SDS) XX SQ MDDLFPLIFPSEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT SQ IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGYYEADLCPDRSIHSFQNLGIQC SQ VKKRDLEQAISQRIQTNNNPFHVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLLLTPVLS SQ HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS SQ QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE SQ KRKRTYETFKSIMKKSPFNGPTEPRPPTRRIAVPTRNSTSVPKPAPQPYTFPASLSTINF SQ DEFSPMLLPSGQISNQALALAPSSAPVLAQTMVPSSAMVPLAQPPAPAPVLTPGPPQSLS SQ APVPKSTQAGEGTLSEALLHLQFDADEDLGALLGNSTDPGVFTDLASVDNSEFQQLLNQG SQ VSMSHSTAEPMLMEYPEAITRLVTGSQRPPDPAPTPLGTSGLPNGLSGDEDFSSIADMDF SQ SALLSQISS XX SC Swiss-Prot#Q04207-1 XX FT 16 190 PS50254; REL_2. FT 21 186 PF00554; Rel homology domain (RHD). FT 193 289 SM00429; iptmega2. FT 194 289 PF01833; IPT/TIG domain. FT 457 482 trans-activation domain 1' (TA1', by homology) [5]. FT 524 549 trans-activation domain 1 (TA1, by homology) [5]. XX IN T01807 Id1; rat, Rattus norvegicus. IN T14419 Id1; human, Homo sapiens. IN T24880 Id2; rat, Rattus norvegicus. IN T10032 Id3; rat, Rattus norvegicus. IN T09437 NF-kappaB1; mouse, Mus musculus. XX MX M00052 V$NFKAPPAB65_01. MX M00054 V$NFKAPPAB_01. MX M00774 V$NFKB_Q6_01. MX M03563 V$RELA_Q6. XX BS R05858. BS R05859. BS R05860. BS R05861. BS R05862. BS R05863. BS R05864. BS R05865. BS R05866. BS R05867. BS R05868. BS R05869. BS R05870. BS R05871. BS R05872. BS R05873. BS R05874. BS R05875. BS R14652. BS R14655. BS R14483. XX DR TRANSPATH: MO000083492. DR EMBL: M61909; MMNFKP65. DR UniProtKB: Q04207-1; XX RN [1]; RE0000176. RX PUBMED: 2001591. RA Nolan G. P., Gosh S., Liou H.-C., Tempst P., Baltimore D. RT DNA binding and IkappaB inhibition of the cloned p65 subunit of NF-kappaB, a rel-related polypeptide RL Cell 64:961-969 (1991). RN [2]; RE0000285. RX PUBMED: 3076097. RA Baeuerle P. A., Lenardo M., Pierce J. W., Baltimore D. RT Phorbol-ester-induced activation of the NF-kappaB transcription factor involves dissociation of an apparently cytoplasmic NF-kappaB/inhibitor complex RL Cold Spring Harb. Symp. Quant. Biol. 53:789-798 (1988). RN [3]; RE0001374. RX PUBMED: 2796988. RA Gustafson T. A., Kedes L. RT Identification of Multiple Proteins That Interact with Functional Regions of the Human Cardiac alpha-Actin Promoter RL Mol. Cell. Biol. 9:3269-3283 (1989). RN [4]; RE0001632. RX PUBMED: 2548081. RA Shirakawa F., Mizel S. B. RT In vitro activation and nuclear translocation of NF-kappaB catalyzed by cyclic AMP-dependent protein kinase and protein kinase C RL Mol. Cell. Biol. 9:2424-2430 (1991). RN [5]; RE0003823. RX PUBMED: 7797554. RA Schmitz M. L., dos Santos Silva M. A., Baeuerle P. A. RT Transactivation domain 2 (TA2) of p65 NF-kappaB RL J. Biol. Chem. 270:15576-15584 (1995). RN [6]; RE0004518. RX PUBMED: 1577272. RA Fujita T., Nolan G. P., Ghosh S., Baltimore D. RT Independent modes of transcriptional activation by the p50 and p65 subunits of NF-kappaB RL Genes Dev. 6:775-787 (1992). RN [7]; RE0004547. RX PUBMED: 7603567. RA Beg A. A., Sha W. C., Bronson R. T., Ghosh S., Baltimore D. RT Embryonic lethality and liver degeneration in mice lacking the ReIA component of NF-kappaB RL Nature 376:167-170 (1995). RN [8]; RE0004550. RX PUBMED: 7867065. RA Thompson J. E., Phillips R. J., Erdjument-Bromage H., Tempst P., Ghosh S. RT IkappaB-beta regulates the persistent response in a biphasic activation of NF-kappaB RL Cell 80:573-582 (1995). RN [9]; RE0004553. RX PUBMED: 1299224. RA Kitajima I., Shinohara T., Bilakovics J., Brown D. A., Xu X., Nerenberg M. RT Ablation of transplanted HTLV-I Tax-transformed tumors in mice by antisense inhibition of NF-kappaB RL Science 258:1792-1795 (1992). RN [10]; RE0006254. RX PUBMED: 8234276. RA Matsusaka T., Fujikawa K., Nishio Y., Mukaida N., Matsushima K., Kishimoto T., Akira S. RT Transcription factors NF-IL6 and NF-kappaB synergistically activate transcription of the inflammatory cytokines interleukin 6 and interleukin 8 RL Proc. Natl. Acad. Sci. USA 90:10193-10197 (1993). RN [11]; RE0025411. RX PUBMED: 15155743. RA Anest V., Cogswell P. C., Baldwin AS J. r. RT IkappaB kinase alpha and p65/RelA contribute to optimal epidermal growth factor-induced c-fos gene expression independent of IkappaBalpha degradation. RL J. Biol. Chem. 279:31183-31189 (2004). RN [12]; RE0054833. RX PUBMED: 17690092. RA Lou H., Kaplowitz N. RT Glutathione depletion down-regulates tumor necrosis factor alpha-induced NF-kappaB activity via IkappaB kinase-dependent and -independent mechanisms. RL J. Biol. Chem. 282:29470-29481 (2007). XX //