TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T09123 XX ID T09123 XX DT 26.07.2006 (created); jag. DT 24.07.2014 (updated); pos. CO Copyright (C), QIAGEN. XX FA E2F-2 XX SY E2F transcription factor 2; E2F-2; E2f2. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G001702 E2F2; HGNC: E2f2. XX CL C0023; fork head. XX SZ 437 AA; 47.5 kDa (cDNA) (calc.). XX SQ MLQGPRALASAAGQTPKVVPAMSPTELWPSGLSSPQLCPATATYYTPLYPQTAPPAAAPG SQ TCLDATPHGPEGQVVRCLPAGRLPAKRKLDLEGIGRPVVPEFPTPKGKCIRVDGLPSPKT SQ PKSPGEKTRYDTSLGLLTKKFIYLLSESEDGVLDLNWAAEVLDVQKRRIYDITNVLEGIQ SQ LIRKKAKNNIQWVGRGMFEDPTRPGKQQQLGQELKELMNTEQALDQLIQSCSLSFKHLTE SQ DKANKRLAYVTYQDIRAVGNFKEQTVIAVKAPPQTRLEVPDRTEDNLQIYLKSTQGPIEV SQ YLCPEEVQEPDSPSEEPLPSTSTLCPSPDSAQPSSSTDPSIMEPTASSVPAPAPTPQQAP SQ PPPSLVPLEATDSLLELPHPLLQQTEDQFLSPTLACSSPLISFSPSLDQDDYLWGLEAGE SQ GISDLFDSYDLGDLLIN XX SC translated from EMBL #L22846 XX FT 129 194 PF02319; E2F/DP family winged-helix DNA-binding domai. XX IN T01548 DP-1; human, Homo sapiens. IN T03000 DP-2; human, Homo sapiens. IN T00752 Sp1; mouse, Mus musculus. XX MX M08875 V$E2F_Q4_03. XX BS R25908. XX DR TRANSPATH: MO000083613. DR EMBL: L22846; DR UniProtKB: Q14209; XX RN [1]; RE0003289. RX PUBMED: 8246995. RA Ivey-Hoyle M., Conroy R., Huber H. E., Goodhart P. J., Oliff A., Heimbrook D. C. RT Cloning and characterization of E2F-2, a novel protein with the biochemical properties of transcription factor E2F RL Mol. Cell. Biol. 13:7802-7812 (1993). RN [2]; RE0003316. RX PUBMED: 8246996. RA Lees J. A., Saito M., Vidal M., Valentine M., Look T., Harlow E., Dyson N., Helin K. RT The retinoblastoma protein binds to a family of E2F transcription factors RL Mol. Cell. Biol. 13:7813-7825 (1993). RN [3]; RE0012787. RX PUBMED: 8657141. RA Karlseder J., Rotheneder H., Wintersberger E. RT Interaction of Sp1 with the growth- and cell cycle regulated transcription factor E2F RL Mol. Cell. Biol. 16:1659-1667 (1996). RN [4]; RE0015322. RX PUBMED: 10090723. RA Zheng N., Fraenkel E., Pabo C. O., Pavletich N. P. RT Structural basis of DNA recognition by the heterodimeric cell cycle transcription factor E2F-DP RL Genes Dev. 13:666-674 (1999). RN [5]; RE0031299. RX PUBMED: 12411495. RA Schlisio S., Halperin T., Vidal M., Nevins J. R. RT Interaction of YY1 with E2Fs, mediated by RYBP, provides a mechanism for specificity of E2F function. RL EMBO J. 21:5775-86 (2002). RN [6]; RE0054737. RX PUBMED: 16512785. RA Kherrouche Z., Blais A., Ferreira E., de Launoit Y., Monte D. RT ASK-1 (apoptosis signal-regulating kinase 1) is a direct E2F target gene. RL Biochem. J. 396:547-556 (2006). XX //