TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T09283 XX ID T09283 XX DT 30.08.2006 (created); man. DT 11.12.2006 (updated); kau. CO Copyright (C), QIAGEN. XX FA MRF4 XX SY MRF4; Myf-6. XX OS rat, Rattus norvegicus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G001055 Myf6. XX CL C0010; bHLH. XX SZ 242 AA; 27.0 kDa (cDNA) (calc.). XX SQ MMMDLFETGSYFFYLDGENVTLQPLEVAEGSPLYPGSDGTLSPCQDQMPQEAGSDSSGEE SQ HVLAPPGLQPPHCPGQCLIWACKTCKRKSAPTDRRKAATLRERRRLKKINEAFEALKRRT SQ VANPNQRLPKVEILRSAINYIERLQDLLHRLDQQEKMQELGVDPYSYKPKQEILEGADFL SQ RTCSPQWPSVSDHSRGLVITAKEGGASVDASASSSLQRLSSIVDSISSEERKLPSVEEVV SQ EK XX SC Swiss-Prot#P19335 XX FT 3 93 PF01586; Myogenic Basic domain. FT 3 98 SM00520; BASIC. FT 93 145 PS50888; HLH. FT 94 145 PF00010; Helix-loop-helix DNA-binding domain. FT 99 99 threonine-phosphorylation by PKC inhibits DNA-binding [9]. FT 99 150 SM00353; finulus. XX IN T00403 Id1; mouse, Mus musculus. IN T10004 Id2; mouse, Mus musculus. IN T09198 Id3; mouse, Mus musculus. IN T09281 MLP; rat, Rattus norvegicus. XX MX M00804 V$E2A_Q2. MX M00973 V$E2A_Q6. MX M01034 V$EBOX_Q6_01. MX M03831 V$MRF4_Q3. MX M00929 V$MYOD_Q6_01. XX BS R00242. BS R02898. XX DR TRANSPATH: MO000086016. DR EMBL: M27151; DR EMBL: M84685; DR UniProtKB: P19335; XX RN [1]; RE0000703. RX PUBMED: 2560751. RA Rhodes S. J., Konieczny S. F. RT Identification of MRF4: a new member of the muscle regulatory factor gene family RL Genes Dev. 3:2050-2061 (1989). RN [2]; RE0000968. RX PUBMED: 1847137. RA Chakraborty T., Brennan T., Olson E. RT Differential trans-activation of a muscle-specific enhancer by myogenic helix-loop-helix proteins is separable from DNA binding RL J. Biol. Chem. 266:2878-2882 (1991). RN [3]; RE0001506. RX PUBMED: 1658626. RA Chakraborty T., Olson E. N. RT Domains outside of the DNA-binding domain impart target gene specificity to myogenin and MRF4 RL Mol. Cell. Biol. 11:6103-6108 (1991). RN [4]; RE0001507. RX PUBMED: 1695319. RA Yutzey K. E., Rhodes S. J., Konieczny S. F. RT Differential trans activation associated with the muscle regulatory factors MyoD1, myogenin, and MRF4 RL Mol. Cell. Biol. 10:3934-3944 (1990). RN [5]; RE0002987. RX PUBMED: 1328851. RA Mak K.-L., To R. Q., Kong Y., Konieczny S. F. RT The MRF4 activation domain is required to induce muscle-specific gene expression RL Mol. Cell. Biol. 12:4334-4346 (1992). RN [6]; RE0003271. RX PUBMED: 1715299. RA Hinterberger T. J., Sassoon D. A., Rhodes S. J., Konieczny S. F. RT Expression of the muscle regulatory factor MRF4 during somite and skeletal myofiber development RL Dev. Biol. 147:144-156 (1991). RN [7]; RE0003274. RX PUBMED: 1639267. RA Hinterberger T. J., Mays J. L., Konieczny S. F. RT Structure and myofiber-specific expression of the rat muscle regulatory gene MRF4 RL Gene 117:201-207 (1992). RN [8]; RE0003406. RX PUBMED: 1311321. RA Lin H., Konieczny S. F. RT Identification of MRF4, myogenin, and E12 oligomer complexes by cheical cross-linking and two-dimensional gel electrophoresis RL J. Biol. Chem. 267:4773-4780 (1992). RN [9]; RE0003407. RX PUBMED: 8413199. RA Hardy S., Kong Y., Konieczny S. F. RT Fibroblast growth factor inhibits MRF4 activity independently of the phosporylation status of a conserved threonine residue within the DNA-binding domain RL Mol. Cell. Biol. 13:5943-5956 (1993). RN [10]; RE0042354. RX PUBMED: 9234731. RA Kong Y., Flick M. J., Kudla A. J., Konieczny S. F. RT Muscle LIM protein promotes myogenesis by enhancing the activity of MyoD RL Mol. Cell. Biol. 17:4750-60 (1997). RN [11]; RE0048980. RX PUBMED: 9242638. RA Langlands K., Yin X., Anand G., Prochownik E. V. RT Differential interactions of Id proteins with basic-helix-loop-helix transcription factors. RL J. Biol. Chem. 272:19785-19793 (1997). XX //