TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T09198 XX ID T09198 XX DT 08.08.2006 (created); man. DT 26.05.2008 (updated); ask. CO Copyright (C), QIAGEN. XX FA Id3 XX SY HLH462; inhibitor of DNA-binding 3. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G006259 Id3. XX CL C0011; HLH. XX SZ 119 AA; 13.1 kDa (cDNA) (calc.). XX SQ MKALSPVRGCYEAVCCLSERSLAIARGRGKSPSTEEPLSLLDDMNHCYSRLRELVPGVPR SQ GTQLSQVEILQRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAELTPELVISKDKRSFCH XX SC Swiss-Prot#P41133 XX FT 25 81 PS50888; HLH. FT 29 81 PF00010; Helix-loop-helix DNA-binding domain. FT 33 86 SM00353; finulus. XX IN T00204 E12; human, Homo sapiens. IN T01786 E12; mouse, Mus musculus. IN T00207 E47; human, Homo sapiens. IN T01788 E47; mouse, Mus musculus. IN T09513 HTF4; mouse, Mus musculus. IN T01496 HTF4alpha; mouse, Mus musculus. IN T01497 HTF4gamma; mouse, Mus musculus. IN T09514 HTF4gamma; human, Homo sapiens. IN T01658 IDB4; mouse, Mus musculus. IN T10008 IDB4; mouse, Mus musculus. IN T19028 ITF-2; mouse, Mus musculus. IN T13873 MITF; Mammalia. IN T09283 MRF4; rat, Rattus norvegicus. IN T00525 MyoD; human, Homo sapiens. IN T09177 MyoD; mouse, Mus musculus. IN T10027 MyoD; Mammalia. XX DR TRANSPATH: MO000084514. DR EMBL: M60523; DR EMBL: M60524; DR UniProtKB: P41133; XX RN [1]; RE0002424. RX PUBMED: 2000388. RA Christy B. A., Sanders L. K., Lau L. F., Copeland N. G., Jenkins N. A., Nathans D. RT An Id-related helix-loop-helix protein encoded by a growth factor-inducible gene RL Proc. Natl. Acad. Sci. USA 88:1815-1819 (1991). RN [2]; RE0003696. RX PUBMED: 8139914. RA Riechmann V., van Cruechten I., Sablitzky F. RT The expression pattern of Id4, a novel dominant negative helix-loop-helix protein, is distinct from Id1, Id2 and Id3 RL Nucleic Acids Res. 22:749-755 (1994). RN [3]; RE0004168. RX PUBMED: 8197168. RA Barone M. V., Pepperkok R., Peverali F. A., Philipson L. RT Id proteins control growth induction in mammalian cells RL Proc. Natl. Acad. Sci. USA 91:4985-4988 (1994). RN [4]; RE0012509. RX PUBMED: 8759016. RA Loveys D. A., Streiff M. B., Kato G. J. RT E2A basic-helix-loop-helix transcription factors are negatively regulated by serum growth factors and by the ld3 protein RL Nucleic Acids Res. 24:2813-2820 (1996). RN [5]; RE0039511. RX PUBMED: 9235903. RA Anand G., Yin X., Shahidi A. K., Grove L., Prochownik E. V. RT Novel regulation of the helix-loop-helix protein Id1 by S5a, a subunit of the 26 S proteasome RL J. Biol. Chem. 272:19140-51 (1997). RN [6]; RE0048980. RX PUBMED: 9242638. RA Langlands K., Yin X., Anand G., Prochownik E. V. RT Differential interactions of Id proteins with basic-helix-loop-helix transcription factors. RL J. Biol. Chem. 272:19785-19793 (1997). XX //