
AC T09177
XX
ID T09177
XX
DT 02.08.2006 (created); man.
DT 24.12.2014 (updated); pro.
CO Copyright (C), QIAGEN.
XX
FA MyoD
XX
SY MEF1; Myoblast determination protein 1; MyoD; MyoD1.
XX
OS mouse, Mus musculus
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae
XX
GE G000576 Myod1.
XX
CL C0010; bHLH.
XX
SZ 318 AA; 34.2 kDa (cDNA) (calc.), 45 kDa (SDS)
XX
SQ MELLSPPLRDIDLTGPDGSLCSFETADDFYDDPCFDSPDLRFFEDLDPRLVHVGALLKPE
SQ EHAHFSTAVHPGPGAREDEHVRAPSGHHQAGRCLLWACKACKRKTTNADRRKAATMRERR
SQ RLSKVNEAFETLKRCTSSNPNQRLPKVEILRNAIRYIEGLQALLRDQDAAPPGAAAFYAP
SQ GPLPPGRGSEHYSGDSDASSPRSNCSDGMMDYSGPPSGPRRQNGYDTAYYSEAVRESRPG
SQ KSAAVSSLDCLSSIVERISTDSPAAPALLLADAPPESPPGPPEGASLSDTEQGTQTPSPD
SQ AAPQCPAGSNPNAIYQVL
XX
SC Swiss-Prot#P10085
XX
FT 1 109
PF01586; Myogenic Basic domain.
FT 1 114
SM00520; BASIC.
FT 100 112
nuclear localization signal (NLS234) [48].
FT 109 161
PS50888; HLH.
FT 110 161
PF00010; Helix-loop-helix DNA-binding domain.
FT 115 166
SM00353; finulus.
FT 130 135
nuclear localization signal (NLS6) [48].
FT 146 146
important for DNA binding [55].
XX
IN T00204 E12; human, Homo sapiens.
IN T05421 E47; golden (Syrian) hamster, Mesocricetus auratus.
IN T00403 Id1; mouse, Mus musculus.
IN T10004 Id2; mouse, Mus musculus.
IN T09198 Id3; mouse, Mus musculus.
IN T10381 ipf1; golden (Syrian) hamster, Mesocricetus auratus.
IN T09177 MyoD; mouse, Mus musculus.
XX
MX M00804 V$E2A_Q2.
MX M00973 V$E2A_Q6.
MX M01034 V$EBOX_Q6_01.
MX M00001 V$MYOD_01.
MX M00184 V$MYOD_Q6.
MX M00929 V$MYOD_Q6_01.
MX M02100 V$MYOD_Q6_02.
XX
BS R41839.
BS R03109.
BS R00012.
BS R00014.
BS R04467.
BS R20591.
BS R20592.
BS R20593.
BS R20595.
BS R20596.
BS R04020.
BS R04021.
BS R04418.
BS R65461.
BS R00242.
BS R26341.
BS R14856.
BS R14857.
BS R14858.
BS R29572.
BS R02898.
XX
DR TRANSPATH: MO000084139.
DR EMBL: M18779;
DR EMBL: X61655;
DR UniProtKB: P10085;
DR PDB: 1mdy.
XX
RN [1]; RE0000052.
RX PUBMED: 2550138.
RA Lassar A. B., Buskin J. N., Lockshon D., Davis R. L., Apone S., Hauschka S. D., Weintraub H.
RT MyoD is a sequence-specific DNA binding protein requiring a region of myc homology to bind to the muscle creatine kinase enhancer
RL Cell 58:823-831 (1989).
RN [2]; RE0000053.
RX PUBMED: 2503252.
RA Murre C., McCaw P. S., Vaessin H., Caudy M., Jan L. Y., Jan Y. N., Cabrera C. V., Buskin J. N., Hauschka S. D., Lassar A. B., Weintraub H., Baltimore D.
RT Interactions between heterologous helix-loop-helix proteins generate complexes that bind specifically to a common DNA sequence
RL Cell 58:537-544 (1989).
RN [3]; RE0000054.
RX PUBMED: 2155707.
RA Davis R. L., Cheng P.-F., Lassar A. B., Weintraub H.
RT The MyoD DNA binding domain contains a recognition code for muscle-specific gene activation
RL Cell 60:733-746 (1990).
RN [4]; RE0000092.
RX PUBMED: 2493990.
RA Murre C., McCaw P. S., Baltimore D.
RT A new DNA binding and dimerization motif in immunoglobulin enhancer binding, daughterless, MyoD, and myc proteins
RL Cell 56:777-783 (1989).
RN [5]; RE0000231.
RX PUBMED: 1846322.
RA Sun X.-H., Baltimore D.
RT An inhibitory domain of E12 transcription factor prevents DNA binding in E12 homodimers but not in E12 heterodimers
RL Cell 64:459-470 (1991).
RN [6]; RE0000238.
RX PUBMED: 1649701.
RA Lassar A. B., Davis R. L., Wright W. E., Kadesch T., Murre C., Voronova A., Baltimore D., Weintraub H.
RT Functional activity of myogenic HLH proteins requires hetero-oligomerization with E12/E47-like proteins in vivo
RL Cell 66:305-315 (1991).
RN [7]; RE0000703.
RX PUBMED: 2560751.
RA Rhodes S. J., Konieczny S. F.
RT Identification of MRF4: a new member of the muscle regulatory factor gene family
RL Genes Dev. 3:2050-2061 (1989).
RN [8]; RE0000968.
RX PUBMED: 1847137.
RA Chakraborty T., Brennan T., Olson E.
RT Differential trans-activation of a muscle-specific enhancer by myogenic helix-loop-helix proteins is separable from DNA binding
RL J. Biol. Chem. 266:2878-2882 (1991).
RN [9]; RE0001484.
RX PUBMED: 2797000.
RA Vaidya T. B., Rhodes S. J., Taparowsky E. J., Konieczny S. F.
RT Fibroblast growth factor and transforming growth factor beta repress transcription of the myogenic regulatory gene MyoD1
RL Mol. Cell. Biol. 9:3576-3579 (1989).
RN [10]; RE0001507.
RX PUBMED: 1695319.
RA Yutzey K. E., Rhodes S. J., Konieczny S. F.
RT Differential trans activation associated with the muscle regulatory factors MyoD1, myogenin, and MRF4
RL Mol. Cell. Biol. 10:3934-3944 (1990).
RN [11]; RE0001620.
RX PUBMED: 1850096.
RA French B. A., Chow K.-L., Olson E. N., Schwartz R. J.
RT Heterodimers of myogenic helix-loop-helix regulatory factors and E12 bind a complex element governing myogenic induction of the avian cardiac alpha-actin promoter
RL Mol. Cell. Biol. 11:2439-2450 (1991).
RN [12]; RE0002458.
RX PUBMED: 2377600.
RA Weintraub H., Davis R., Lockshon D., Lassar A.
RT MyoD binds cooperatively to two sites in a target enhancer sequence: Occupancy of two sites is required for activation
RL Proc. Natl. Acad. Sci. USA 87:5623-5627 (1990).
RN [13]; RE0002654.
RX PUBMED: 3175662.
RA Tapscott S. J., Davis R. L., Thayer M. J., Cheng P., Weintraub H., Lassar A. B.
RT MyoD1: a nuclear phosphoprotein requiring a Myc homology region to convert fibroblasts to myoblasts
RL Science 242:405-411 (1988).
RN [14]; RE0002661.
RX PUBMED: 2174572.
RA Blackwell T. K., Weintraub H.
RT Differences and similarities in DNA-binding preferences of MyoD and E2A protein complexes revealed by binding site selection
RL Science 250:1104-1110 (1990).
RN [15]; RE0002662.
RX PUBMED: 1312255.
RA Anthony-Cahill S. J., Benfield P. A., Fairman R., Wasserman Z. R., Brenner S. L., Stafford III W. F., Altenbach C., Hubbell W. L., DeGrado W. F.
RT Molecular characterization of helix-loop-helix peptides
RL Science 255:979-983 (1992).
RN [16]; RE0002942.
RX PUBMED: 1406681.
RA Shaknovich R., Shue G., Kohtz D. S.
RT Conformational activation of a basic helix-loop-helix protein (MyoD1) by the C-terminal region of murine HSP90 (HSP84)
RL Mol. Cell. Biol. 12:5059-5068 (1992).
RN [17]; RE0003172.
RX PUBMED: 3600660.
RA Olson E.N., Spizz G., Tainsky M.A.
RT The Oncogenic Forms of N-ras or H-ras Prevent Skeletal Myoblast Differentiation
RL Mol. Cell. Biol. 7:2104-2111 (1987).
RN [18]; RE0003211.
RX PUBMED: 2430720.
RA Lassar A. B., Paterson B. M., Weintraub H.
RT Transfection of a DNA locus that mediates the conversion of 10T1/2 fibroblasts into myoblasts
RL Cell 47:649-656 (1986).
RN [19]; RE0003212.
RX PUBMED: 3690668.
RA Davis R. L., Weintraub H., Lassar A. B.
RT Expression of a single transfected cDNA converts fibroblasts into myoblasts
RL Cell 51:987-1000 (1987).
RN [20]; RE0003213.
RX PUBMED: 2552320.
RA Sassoon D., Lyons G., Wright W. E., Lin V., Lassar A. B., Weintraub H., Buckingham M.
RT Expression of two myogenic regulatory factors myogenin and MyoD1 during mouse embryogenesis
RL Nature 341:303-307 (1989).
RN [21]; RE0003214.
RX PUBMED: 2548731.
RA Lassar A. B., Thayer M. J., Overell R. W., Weintraub H.
RT Transformation by activated ras or fos prevents myogenesis by inhibiting expression of MyoD1
RL Cell 58:659-667 (1989).
RN [22]; RE0003215.
RX PUBMED: 2748593.
RA Weintraub H., Tapscott S. J., Davis R. L., Thayer M. J., Adam M. A., Lassar A. B., Miller A. D.
RT Activation of muscle-specific genes in pigment, nerve, fat, liver, and fibroblast cell lines by forced expression of MyoD
RL Proc. Natl. Acad. Sci. USA 86:5434-5438 (1989).
RN [23]; RE0003216.
RX PUBMED: 2546677.
RA Thayer M. J., Tapscott S. J., Davis R. L., Wright W. E., Lassar A. B., Weintraub H.
RT Positive autoregulation of the myogenic determination gene MyoD1
RL Cell 58:241-248 (1989).
RN [24]; RE0003218.
RX PUBMED: 2359457.
RA Sorrentino V., Pepperkok R., Davis R. L., Ansorge W., Philipson L.
RT Cell proliferation inhibited by MyoD1 independently of myogenic differentiation
RL Nature 345:813-815 (1990).
RN [25]; RE0003222.
RX PUBMED: 1311614.
RA Fuechtbauer E. M., Westphal H.
RT MyoD and myogenin are coexpressed in regulating skeletal muscle of the mouse
RL Dev. Dyn. 193:34-39 (1992).
RN [26]; RE0003223.
RX PUBMED: 1850105.
RA Miner J. H., Wold B. J.
RT c-myc inhibition of MyoD and myogenin-initiated myogenic differentiation
RL Mol. Cell. Biol. 11:2842-2851 (1992).
RN [27]; RE0003225.
RX PUBMED: 1313772.
RA Li L., Chambard J. C., Karin M., Olson E. N.
RT Fos and Jun repress transcriptional activation by myogenin and MyoD: the amino terminus of Jun can mediate repression
RL Genes Dev. 6:676-689 (1992).
RN [28]; RE0003226.
RX PUBMED: 1406697.
RA Carnac G., Albagli-Curiel O., Vandromme M., Pinset C., Montarras D., Laudet V., Bonnieu A.
RT 3, 5, 3 - triiodothyronine positively regulates both MyoD1 gene transcription and terminal differentiation in C2 myoblasts
RL Mol. Endocrinol. 6:1185-1194 (1992).
RN [29]; RE0003227.
RX PUBMED: 1329087.
RA van Antwerp M. E., Chen D. G., Chang C., Prochownik E. V.
RT A point mutation in MyoD basic domain imparts c-Myc-like properties
RL Proc. Natl. Acad. Sci. USA 89:9010-9014 (1992).
RN [30]; RE0003228.
RX PUBMED: 1321827.
RA Kim S. J., Kim K. Y., Tapscott S. J., Winokur T. S., Park K., Fujiki H., Weintraub H., Roberts A. B.
RT Inhibition of protein phosphatases blocks myogenesis by first altering MyoD binding activity
RL J. Biol. Chem. 267:15140-15145 (1992).
RN [31]; RE0003232.
RX PUBMED: 8393567.
RA Thayer M. J., Weintraub H.
RT A cellular factor stimulates the DNA-binding activity of MyoD and E47
RL Proc. Natl. Acad. Sci. USA 90:6483-6487 (1993).
RN [32]; RE0003234.
RX PUBMED: 8387507.
RA Winter B., Braun T., Arnold H. H.
RT cAMP-dependent protein kinase represses myogenic differentiation and the activity of the muscle-specific helix-loop-helix transcription factors Myf-5 and MyoD
RL J. Biol. Chem. 13:9869-9878 (1993).
RN [33]; RE0003236.
RX PUBMED: 8381715.
RA Gu W., Schneider J. W., Condorelli G., Kaushal S., Mahdavi V., Nadal-Ginard B.
RT Interaction of myogenic factors and the retinoblastoma protein mediates muscle cell commitment and differentiation
RL Cell 72:309-324 (1993).
RN [34]; RE0003238.
RX PUBMED: 8396258.
RA Hollenberg S. M., Cheng P. F., Weintraub H.
RT Use of a conditional MyoD transcription factor in studies of MyoD trans-activation and muscle determination
RL Proc. Natl. Acad. Sci. USA 90:8028-8032 (1993).
RN [35]; RE0003239.
RX PUBMED: 8269513.
RA Rudnicki M. A., Schnegelsberg P. N. J., Stead R. H., Braun T., Arnold H. H., Jaenisch R.
RT MyoD or Myf-5 is required for the formation of skeletal muscle
RL Cell 75:1351-1359 (1993).
RN [36]; RE0003240.
RX PUBMED: 8127707.
RA Muscat G. E. O., Mynett-Johnson L., Dowhan D., Downes M., Griggs R.
RT Activation of MyoD gene transcription by 3, 4, 3'-triiodo-L-thyronine: a direct role for the thyroid hormone and retinoid X receptors
RL Nucleic Acids Res. 22:583-591 (1994).
RN [37]; RE0003241.
RX PUBMED: 8120060.
RA Pedraza-Alva G., Zingg J. M., Jost J. P.
RT AP-1 binds to a putative cAMP response element of the MyoD1 promoter and negatively modulates MyoD1 expression in dividing myoblasts
RL J. Biol. Chem. 269:6978-6985 (1994).
RN [38]; RE0003242.
RX PUBMED: 7958889.
RA Weintraub H., Genetta T., Kadesch T.
RT Tissue-specific gene activation by MyoD: determination of specificity by cis-acting repression elements
RL Genes Dev. 8:2203-2211 (1994).
RN [39]; RE0003244.
RX PUBMED: 1330322.
RA Rudnicki M. A., Braun T., Hinuma S., Jaenisch R.
RT Inactivation of MyoD in mice leads to up-regulation of the myogenic HLH gene Myf-5 and results in apparently normal muscle development
RL Cell 71:383-390 (1992).
RN [40]; RE0003392.
RX PUBMED: 8181063.
RA Ma P. C. M., Rould M. A., Weintraub H., Pabo C. O.
RT Crystal structure of MyoD bHLH domain-DNA complex: perspectives on DNA recognition and implications for transcriptional activation
RL Cell 77:451-459 (1994).
RN [41]; RE0003393.
RX PUBMED: 8479534.
RA Ferre-D'Amare A. E., Prendergast G. C., Ziff E. B., Burley S. K.
RT Recognition by Max of its cognate DNA through a dimeric b/HLH/Z domain
RL Nature 363:38-45 (1993).
RN [42]; RE0003394.
RX PUBMED: 8306960.
RA Ferre-D'Amare A. R., Pognonec P., Roeder R. G., Burley S. K.
RT Structure and function of the b/HLH/Z domain of USF
RL EMBO J. 13:180-189 (1994).
RN [43]; RE0003414.
RX PUBMED: 1651276.
RA Weintraub H., Dwarki V. J., Verma I., Davis R. L., Hollenberg S., Snider L., Lassar A. B., Tapscott S. J.
RT Muscle-specific transcriptional activation by MyoD
RL Genes Dev. 5:1377-1386 (1991).
RN [44]; RE0003415.
RX PUBMED: 8248126.
RA Fairman R., Beran-Steed R. K., Anthony-Cahill S. J., Lear J. D., Stafford III W. F., DeGrado W. F., Benfield P. A., Brenner S. L.
RT Multiple oligomeric states regulate the DNA binding of helix-loop-helix proteins
RL Proc. Natl. Acad. Sci. USA 90:10429-10433 (1993).
RN [45]; RE0003416.
RX PUBMED: 8300601.
RA Shue G., Kohtz D.
RT Structural and functional aspects of basic helix-loop-helix protein folding by heat-shock protein
RL J. Biol. Chem. 269:2707-2711 (1994).
RN [46]; RE0003417.
RX PUBMED: 2236052.
RA Crescenzi M., Fleming T. P., Lassar A. B., Weintraub H., Aaronson S. A.
RT MyoD induces growth arrest independent of differentiation in normal and transformed cells
RL Proc. Natl. Acad. Sci. USA 87:8442-8446 (1990).
RN [47]; RE0003418.
RX PUBMED: 1310896.
RA Bengal E., Ransone L., Scharfmann R., Dwarki V. J., Tapscott S. J., Weintraub H., Verma I. M.
RT Functional antagonism between c-Jun and MyoD proteins: a direct physical association
RL Cell 68:507-519 (1992).
RN [48]; RE0005811.
RX PUBMED: 7753857.
RA Vandromme M., Cavadore J.-C., Bonnieu A., Froeschle A., Lamb N., Fernandez A.
RT Two nuclear localization signals present in the basic-helix 1 domains of MyoD promote its active nuclear translocation and can function independly
RL Proc. Natl. Acad. Sci. USA 92:4646-4650 (1995).
RN [49]; RE0012509.
RX PUBMED: 8759016.
RA Loveys D. A., Streiff M. B., Kato G. J.
RT E2A basic-helix-loop-helix transcription factors are negatively regulated by serum growth factors and by the ld3 protein
RL Nucleic Acids Res. 24:2813-2820 (1996).
RN [50]; RE0016247.
RX PUBMED: 10629047.
RA Ohneda K., Mirmira R. G., Wang J., Johnson J. D., German M. S.
RT The homeodomain of PDX-1 mediates multiple protein-protein interactions in the formation of a transcriptional activation complex on the insulin promoter.
RL Mol. Cell. Biol. 20:900-911 (2000).
RN [51]; RE0018254.
RX PUBMED: 12037571.
RA Ge K., Guermah M., Yuan C. X., Ito M., Wallberg A. E., Spiegelman B. M., Roeder R. G.
RT Transcription coactivator TRAP220 is required for PPAR gamma 2-stimulated adipogenesis.
RL Nature 417:563-567 (2002).
RN [52]; RE0039511.
RX PUBMED: 9235903.
RA Anand G., Yin X., Shahidi A. K., Grove L., Prochownik E. V.
RT Novel regulation of the helix-loop-helix protein Id1 by S5a, a subunit of the 26 S proteasome
RL J. Biol. Chem. 272:19140-51 (1997).
RN [53]; RE0048980.
RX PUBMED: 9242638.
RA Langlands K., Yin X., Anand G., Prochownik E. V.
RT Differential interactions of Id proteins with basic-helix-loop-helix transcription factors.
RL J. Biol. Chem. 272:19785-19793 (1997).
RN [54]; RE0052561.
RX PUBMED: 11285237.
RA Mal A., Sturniolo M., Schiltz R. L., Ghosh M. K., Harter M. L.
RT A role for histone deacetylase HDAC1 in modulating the transcriptional activity of MyoD: inhibition of the myogenic program.
RL EMBO J. 20:1739-1753 (2001).
RN [55]; RE0042297.
RX PUBMED: 10944526.
RA Polesskaya A., Duquet A., Naguibneva I., Weise C., Vervisch A., Bengal E., Hucho F., Robin P., Harel-Bellan A.
RT CREB-binding Protein/p300 activates MyoD by acetylation
RL J. Biol. Chem. 275:34359-64 (2000).
XX
//