TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T01786 XX ID T01786 XX DT 30.04.1996 (created); ewi. DT 29.07.2014 (updated); yre. CO Copyright (C), QIAGEN. XX FA E12 XX SY a1; A7; AA408400; ALF2; AW209082; bHLHb21; E12; E12/E47; E2A; E47; ME2; Pan1; PAN2; TCF-3; TCF3; Tcfe2a; transcription factor 3; transcription factor E2a; VDIR. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G005705 Tcf3. XX CL C0010; bHLH; 1.2.1.0.1.1. XX SZ 651 AA; 67.7 kDa (cDNA) (calc.). XX SQ MMNQSQRMAPVGSDKELSDLLDFSMMFPLPVANGKSRPASLGGTQFAGSGLEDRPSSGSW SQ GSSDQNSSSFDPSRTYSEGAHFSDSHSSLPPSTFLGAGLGGKGSERNAYATFGRDTSVGT SQ LSQAGFLPGELSLSSPGPLSPSGIKSSSQYYPSFPSNPRRRAADGGLDTQPKKVRKVPPG SQ LPSSVYPPSSGDSYSRDAAAYPSAKTPSSAYPSPFYVADGSLHPSAELWSTPSQVGFGPM SQ LGDGSSPLPLAPGSSSVGSGTFGGLQQQDRMGYQLHGSEVNGSLPAVSSFSAAPGTYSGT SQ SGHTPPVSGAAAESLLGTRGTTASSSGDALGKALASIYSPDHSSNNFSPSPSTPVGSPQG SQ LPGTSQWPRAGAPSALSPNYDAGLHGLSKMEDRLDEAIHVLRSHAVGTASDLHGLLPGHG SQ ALTTSFTGPMSLGGRHAGLVGGSHPEEGLTSGASLLHNHASLPSQPSSLPDLSQRPPDSY SQ SGLGRAGTTAGASEIKREEKEDEEIASVADAEEDKKDLKVPRTRTSPDEDEDDLLPPEQK SQ AEREKERRVANNARERLRVRDINEAFKELGRMCQLHLSSEKPQTKLLILHQAVAVILSLE SQ QQVRERNLNPKAACLKRREEEKVSGVVGDPQLALSAAHPGLGEAHNPAGHL XX SC Swiss-Prot#P15806-1 XX SF homodimers and heterodimers with MASH-2 or ITF-2 are inhibited from DNA-binding by interaction of the bHLH domain with calcium/calmodulin complexes, whereas E12/MyoD heterodimers are resistant [5]; SF flanking bases of the IgH E-box specifically allow interaction with E12/E47 and repress activation by MyoD [1]; SF product of the E2A gene; XX FF functional redundancy of E2A and E2-2 gene products, except mature B cells where E2A products (E12/E47) are found exclusively making mature B cell development E2A-dependent [3] [4]; FF required for Pax-5 T01201 expression [4]; XX IN T00404 Id2; mouse, Mus musculus. IN T09198 Id3; mouse, Mus musculus. IN T01619 MASH-1; mouse, Mus musculus. IN T09295 MASH-1; mouse, Mus musculus. IN T09293 Ngn-2; mouse, Mus musculus. XX MX M00693 V$E12_Q6. MX M00804 V$E2A_Q2. MX M00973 V$E2A_Q6. MX M02088 V$E2A_Q6_01. MX M07353 V$E2A_Q6_02. MX M00002 V$E47_01. MX M00071 V$E47_02. MX M01034 V$EBOX_Q6_01. MX M00222 V$HAND1E47_01. MX M00929 V$MYOD_Q6_01. MX M00066 V$TAL1ALPHAE47_01. MX M00065 V$TAL1BETAE47_01. MX M02823 V$TCFE2A_03. MX M02927 V$TCFE2A_04. XX BS R04764. BS R16617. BS R00019. BS R16654. BS R13322. BS R21454. BS R14863. BS R14864. BS R26342. BS R14856. BS R14858. XX DR TRANSPATH: MO000025923. DR EMBL: D29919; DR EMBL: U14947; DR UniProtKB: P15806-1; XX RN [1]; RE0003242. RX PUBMED: 7958889. RA Weintraub H., Genetta T., Kadesch T. RT Tissue-specific gene activation by MyoD: determination of specificity by cis-acting repression elements RL Genes Dev. 8:2203-2211 (1994). RN [2]; RE0004015. RX PUBMED: 8479911. RA Aronheim A., Shiran R., Rosen A., Walker M. D. RT Cell-specific expression of helix-loop-helix transcription factors encoded by the E2A gene RL Nucleic Acids Res. 21:1601-1606 (1993). RN [3]; RE0004017. RX PUBMED: 1465450. RA Zhuang Y., Kim C. G., Bartelmez S., Cheng P., Groudine M., Weintraub H. RT Helix-loop-helix transcription factors E12 and E47 are not essential for skeletal or cardiac myogenesis, erythrpoiesis, chondrogenesis or neurogenesis RL Proc. Natl. Acad. Sci. USA 89:12132-12136 (1992). RN [4]; RE0004022. RX PUBMED: 8001125. RA Bain G., Maandag E. C. R., Izon D. J., Amsen D., Kruisbeek A. M., Weintraub B. C., Krop I., Schlissel M. S., Feeney A. J., van Roon M., van der Falk M., te Riele H. P. J., Berns A., Murre C. RT E2A proteins are required for proper B cell development and initiation of immunoglobulin gene rearrangements RL Cell 79:885-892 (1994). RN [5]; RE0004024. RX PUBMED: 8152489. RA Corneliussen B., Holm M., Waltersson Y., Onions J., Hallberg B., Thornell A., Grundstroem T. RT Calcium/calmodulin inhibition of basic-helix-loop-helix transcription factor domains RL Nature 368:760-764 (1994). RN [6]; RE0012509. RX PUBMED: 8759016. RA Loveys D. A., Streiff M. B., Kato G. J. RT E2A basic-helix-loop-helix transcription factors are negatively regulated by serum growth factors and by the ld3 protein RL Nucleic Acids Res. 24:2813-2820 (1996). RN [7]; RE0048188. RX PUBMED: 8948587. RA Gradwohl G., Fode C., Guillemot F. RT Restricted expression of a novel murine atonal-related bHLH protein in undifferentiated neural precursors. RL Dev. Biol. 180:227-241 (1996). RN [8]; RE0048956. RX PUBMED: 10924525. RA Firulli B. A., Hadzic D. B., McDaid J. R., Firulli A. B. RT The basic helix-loop-helix transcription factors dHAND and eHAND exhibit dimerization characteristics that suggest complex regulation of function. RL J. Biol. Chem. 275:33567-33573 (2000). RN [9]; RE0049091. RX PUBMED: 12200424. RA Heng J. I., Tan S. S. RT Cloning and characterization of GRIPE, a novel interacting partner of the transcription factor E12 in developing mouse forebrain. RL J. Biol. Chem. 277:43152-43159 (2002). XX //