AC T09343
XX
ID T09343
XX
DT 28.09.2006 (created); man.
DT 15.05.2015 (updated); jtr.
CO Copyright (C), QIAGEN.
XX
FA SRF
XX
SY CArG-binding factor; p67; p67SRF; serum response factor; Serum Responsive Factor; SRF.
XX
OS human, Homo sapiens
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates
XX
GE G003938 SRF; HGNC: SRF.
XX
CL C0014; MADS.
XX
SZ 508 AA; 51.6 kDa (cDNA) (calc.), 64, 67 kDa (SDS)
XX
SQ MLPTQAGAAAALGRGSALGGSLNRTPTGRPGGGGGTRGANGGRVPGNGAGLGPGRLEREA
SQ AAAAATTPAPTAGALYSGSEGDSESGEEEELGAERRGLKRSLSEMEIGMVVGGPEASAAA
SQ TGGYGPVSGAVSGAKPGKKTRGRVKIKMEFIDNKLRRYTTFSKRKTGIMKKAYELSTLTG
SQ TQVLLLVASETGHVYTFATRKLQPMITSETGKALIQTCLNSPDSPPRSDPTTDQRMSATG
SQ FEETDLTYQVSESDSSGETKDTLKPAFTVTNLPGTTSTIQTAPSTSTTMQVSSGPSFPIT
SQ NYLAPVSASVSPSAVSSANGTVLKSTGSGPVSSGGLMQLPTSFTLMPGGAVAQQVPVQAI
SQ QVHQAPQQASPSRDSSTDLTQTSSSGTVTLPATIMTSSVPTTVGGHMMYPSPHAVMYAPT
SQ SGLGDGSLTVLNAFSQAPSTMQVSHSQVQEPGGVPQVFLTASSGTVQIPVSAVQLHQMAV
SQ IGQQAGSSSNLTELQVVNLDTAHSTKSE
XX
SC Swiss-Prot#P11831
XX
FT 77 85 
N-terminal phosphorylation sites [31].
FT 83 83 
phosphorylatable SER83 by casein kinase II (CKII) [17].
FT 103 103 
Phosphorylatable SER103 by protein kinase MCKII [44].
FT 130 280 
interaction with GATA-4 [70].
FT 132 222 
sufficient for dimerization, DNA binding, DNA bending, interactions with Elk-1 [63].
FT 132 264 
DNA-binding domain (DBD) [19].
FT 133 265 
interaction with C/EBPbeta [73].
FT 133 266 
interactions with myocardin [65].
FT 141 200 
SM00432; MADS.
FT 141 201 
PS50066; MADS_BOX_2.
FT 142 171 interaction with GATA-4 [58].
FT 149 199 PF00319; SRF-type transcription factor (DNA-binding a.
FT 153 179 alpha-helix alpha-I [19].
FT 157 157 R (essential for DNA binding) [49].
FT 160 160 Phosphorylatable Thr-160 by protein kinase CaMKII [53].
FT 164 164 R (essential for DNA binding) [49].
FT 168 222 dimerization [19].
FT 182 188 beta-strand beta-I [37].
FT 189 193 beta-turn [37].
FT 193 508 PF00478; IMP dehydrogenase / GMP reductase domain.
FT 194 198 beta-strand beta-II [37].
FT 196 196 defines part of the binding surface for both Elk-1 and Fli-1 [67].
FT 199 208 coil [37].
FT 204 244 interactions with TEF-1 [69].
FT 206 289 C-terminal phosphorylation sites [32].
FT 209 219 alpha-helix alpha-II [37].
FT 277 277 O-GlcNAc modification (Ser277) [54].
FT 306 312 O-GlcNAc modification (Ser307 or Ser309) [54].
FT 316 316 O-Glc-NAc modification (Ser316) [54].
FT 383 385 O-Glc-NAc modification (Ser383, Ser384 or Ser385) [54].
FT 412 508 interactions with a coactivator [82].
XX
IN T02686 GATA-6; mouse, Mus musculus.
IN T14202 GKLF; Mammalia.
IN T25635 myocardin; mouse, Mus musculus.
IN T08563 NF-YA; Mammalia.
IN T04255 NKX3A; human, Homo sapiens.
IN T16826 NKX3A; mouse, Mus musculus.
XX
MX M00152 V$SRF_01.
MX M01257 V$SRF_02.
MX M00215 V$SRF_C.
MX M07618 V$SRF_Q3.
MX M00810 V$SRF_Q4.
MX M00922 V$SRF_Q5_01.
MX M01007 V$SRF_Q5_02.
MX M00186 V$SRF_Q6.
XX
BS R09598.
BS R02129.
BS R00031.
BS R03495.
BS R03496.
BS R27627.
BS R16077.
BS R26724.
BS R14969.
BS R31553.
BS R03412.
BS R00024.
BS R31436.
BS R31548.
BS R37664.
BS R14818.
BS R66501.
BS R14962.
BS R00464.
BS R00466.
BS R09705.
BS R22283.
BS R37662.
BS R37663.
BS R02907.
BS R09538.
BS R03375.
BS R01795.
BS R01796.
BS R01797.
BS R09704.
BS R00472.
BS R14859.
BS R31557.
BS R67659.
BS R16115.
BS R09532.
BS R31434.
BS R09533.
BS R21513.
BS R09597.
BS R14841.
BS R14882.
BS R14955.
BS R02246.
BS R00051.
BS R33341.
BS R03582.
BS R03590.
XX
DR TRANSPATH: MO000087956.
DR TRANSCOMPEL: C00508.
DR TRANSCOMPEL: C00511.
DR EMBL: J03161;
DR UniProtKB: P11831;
DR PDB: 1SRS.
XX
RN [1]; RE0000067.
RX PUBMED: 3524858.
RA Treisman R.
RT Identification of a protein-binding site that mediates transcriptional response of the c-fos gene to serum factors
RL Cell 46:567-574 (1986).
RN [2]; RE0000068.
RX PUBMED: 2492906.
RA Shaw P. E., Schroeter H., Nordheim A.
RT The Ability of a Ternary Complex to Form Over the Serum Response Element Correlates with Serum Inducibility of the Human c-fos Promoter
RL Cell 56:563-572 (1989).
RN [3]; RE0000311.
RX PUBMED: 3582369.
RA Mohun T., Garrett N., Treisman R.
RT Xenopus cytoskeletal actin and human c-fos gene promoters share a conserved protein-binding site
RL EMBO J. 6:667-673 (1987).
RN [4]; RE0000343.
RX PUBMED: 2108863.
RA Schroeter H., Mueller C. G. F., Meese K., Nordheim A.
RT Synergism in ternary complex formation between the dimeric glycoprotein p67SRF, polypeptide p62TCF and the c-fos serum response element
RL EMBO J. 9:1123-1130 (1990).
RN [5]; RE0000418.
RX PUBMED: 3119326.
RA Treisman R.
RT Identification and purification of a polypeptide that binds to the c-fos serum response element
RL EMBO J. 6:2711-2717 (1987).
RN [6]; RE0000426.
RX PUBMED: 2511007.
RA Shaw P. E., Frasch S., Nordheim A.
RT Repression of c-fos transcription is mediated through p6SRF bound to the SRE
RL EMBO J. 8:2567-2574 (1989).
RN [7]; RE0000531.
RX PUBMED: 1425594.
RA Treisman R., Marais R., Wynne J.
RT Spatial flexibility in ternary complexes between SRF and its accessory proteins
RL EMBO J. 11:4631-4640 (1992).
RN [8]; RE0000532.
RX PUBMED: 1756729.
RA Mueller C. G. F., Nordheim A.
RT A protein domain conserved between yeast MCM1 and human SRF directs ternary complex formation
RL EMBO J. 10:4219-4229 (1991).
RN [9]; RE0000639.
RX PUBMED: 3071491.
RA Hayes T. E., Sengupta P., Cochran B. H.
RT The human c-fos serum response factor and the yeast factors GRM/PRTF have related DNA-binding specificities
RL Genes Dev. 2:1713-1722 (1988).
RN [10]; RE0000770.
RX PUBMED: 2200737.
RA Manak J. R., de Bisschop N., Kris R. M., Prywes R.
RT Casein kinase II enhances the DNA binding activity of serum response factor
RL Genes Dev. 4:955-967 (1990).
RN [11]; RE0000817.
RX PUBMED: 3372525.
RA Smith J. D., Melian A., Leff T., Breslow J. L.
RT Expression of the Human Apolipoprotein E Gene is Regulated by Multiple Positive and Negative Elements
RL J. Biol. Chem. 263:8300-8308 (1988).
RN [12]; RE0001200.
RX PUBMED: 2710114.
RA Boxer L. M., Prywes R., Roeder R. G., Kedes L.
RT The Sarcomeric Actin CArG-Binding Factor Is Indistinguishable from the c-fos Serum Response Factor
RL Mol. Cell. Biol. 9:515-522 (1989).
RN [13]; RE0001203.
RX PUBMED: 2501661.
RA Walsh K.
RT Cross-Binding of Factors to Functionally Different Promoter Elements in c-fos and Skeletal Actin Genes
RL Mol. Cell. Biol. 9:2191-2201 (1989).
RN [14]; RE0001205.
RX PUBMED: 3561415.
RA Greenberg M. E., Siegfried Z., Ziff E. B.
RT Mutation of the c-fos gene dyad symmetry element inhibits serum inducibility of transcription in vivo and the nuclear regulatory factor binding in vitro
RL Mol. Cell. Biol. 7:1217-1225 (1987).
RN [15]; RE0001303.
RX PUBMED: 2496302.
RA Chavrier P., Janssen-Timmen U., Mattei M.-G., Zerial M., Bravo R., Charnay P.
RT Structure, Chromosome Location and Expression of the Mouse Zinc Finger Gene Krox-20: Multiple Gene Products and Coregulation with the Proto-Oncogene c-fos
RL Mol. Cell. Biol. 9:787-797 (1989).
RN [16]; RE0001393.
RX PUBMED: 2513479.
RA Christy B., Nathans D.
RT Functional Serum Response Elements Upstream of the Growth Factor-Inducible Gene zif268
RL Mol. Cell. Biol. 9:4889-4895 (1989).
RN [17]; RE0001496.
RX PUBMED: 2046671.
RA Manak J. R., Prywes R.
RT Mutation of serum response factor phosphorylation sites and the mechanism by which its DNA-binding activity is increased by casein kinase II
RL Mol. Cell. Biol. 11:3652-3659 (1991).
RN [18]; RE0001687.
RX PUBMED: 1508214.
RA Gualberto A., LePage D., Pons G., Mader S. L., Park K., Atchison M. L., Walsh K.
RT Functional antagonism between YY1 and the serum response factor
RL Mol. Cell. Biol. 12:4209-4214 (1992).
RN [19]; RE0001688.
RX PUBMED: 8417320.
RA Sharrocks A. D., Gille H., Shaw P. E.
RT Identification of amino acids essential for DNA binding and dimerization in p67SRF: implications for a novel DNA-binding motif
RL Mol. Cell. Biol. 13:123-132 (1993).
RN [20]; RE0001867.
RX PUBMED: 1722028.
RA Hipskind R. A., Rao V. N., Mueller C. G. F., Reddy E. S. P., Nordheim A.
RT Ets-related protein Elk-1 is homologous to the c-fos regulatory factor p62TCF
RL Nature 354:531-534 (1991).
RN [21]; RE0001949.
RX PUBMED: 2911466.
RA Frederickson R. M., Micheau M. R., Iwamoto A., Miyamoto N. G.
RT 5' flanking and first intron sequences of the human beta-actin gene required for efficient promoter activity
RL Nucleic Acids Res. 17:253-270 (1989).
RN [22]; RE0001974.
RX PUBMED: 3320962.
RA Schroeter H., Shaw P. E., Nordheim A.
RT Purification of intercalator-released p67, a polypeptide that interacts specifically with the c-fos serum response element
RL Nucleic Acids Res. 15:10145-10158 (1987).
RN [23]; RE0001975.
RX PUBMED: 2493627.
RA Leung S., Miyamoto N. G.
RT Point mutational analysis of the human c-fos serum response factor binding site
RL Nucleic Acids Res. 17:1177 (1989).
RN [24]; RE0002166.
RX PUBMED: 2062642.
RA Latinkic B. V., O'Brien T. P., Lau L. F.
RT Promoter function and structure of the growth factor-inducible immediate early gene cyr61
RL Nucleic Acids Res. 19:3261 (1991).
RN [25]; RE0002185.
RX PUBMED: 8095095.
RA Sharrocks A. D., von Hesler F., Shaw P. E.
RT The identification of elements determining the different DNA binding specificities of the MADS box proteins p67SRF and RSRFC4
RL Nucleic Acids Res. 21:215-221 (1993).
RN [26]; RE0002364.
RX PUBMED: 2845402.
RA Prywes R., Dutta A., Cromlish J. A., Roeder R. G.
RT Phosphorylation of serum response factor, a factor that binds to the serum response element of the c-FOS enhancer
RL Proc. Natl. Acad. Sci. USA 85:7206-7210 (1988).
RN [27]; RE0004114.
RX PUBMED: 7623803.
RA Nurrish S. J., Treisman R.
RT DNA binding specificity determinants in MADS-box transcription factors
RL Mol. Cell. Biol. 15:4076-4085 (1995).
RN [28]; RE0004128.
RX PUBMED: 2169025.
RA Schalasta G., Doppler C.
RT Inhibition of c-fos transcription and phosphorylation of the serum response factor by an inhibitor of phospholipase C-type reactions
RL Mol. Cell. Biol. 10:5558-5561 (1990).
RN [29]; RE0004129.
RX PUBMED: 1909174.
RA Zhu H., Roy A. L., Roeder R. G., Prywes R.
RT Serum response factor affects preinitiation complex formation by TFIID in vitro
RL New Biol. 3:455-464 (1991).
RN [30]; RE0004130.
RX PUBMED: 1740119.
RA Marais R. M., Hsuan J. J., McGuigan C., Wynne J., Treisman R.
RT Casein kinase II phosphorylation increases the rate of serum response factor-binding site exchange
RL EMBO J. 11:97-105 (1992).
RN [31]; RE0004131.
RX PUBMED: 1547771.
RA Janknecht R., Hipskind R. A., Houthaeve T., Nordheim A., Stunnenberg H. G.
RT Identification of multiple SRF N-terminal phosphorylation sites affecting DNA binding properties
RL EMBO J. 11:1045-1054 (1992).
RN [32]; RE0004132.
RX PUBMED: 8375385.
RA Janknecht R., Ernst W. H., Houthaeve T., Nordheim A.
RT C-terminal phosphorylation of the serum-response factor
RL Eur. J. Biochem. 216:469-475 (1993).
RN [33]; RE0004133.
RX PUBMED: 1531519.
RA Prywes R., Zhu H.
RT In vitro squelching of activated transcription by serum response factor: evidence for a common coactivator used by multiple transcriptional activators
RL Nucleic Acids Res. 20:513-520 (1992).
RN [34]; RE0004134.
RX PUBMED: 8336707.
RA Johansen F.-E., Prywes R.
RT Identification of transcriptional activation and inhibitory domains in serum response factor (SRF) by using GAL4-SRF constructs
RL Mol. Cell. Biol. 13:4640-4647 (1993).
RN [35]; RE0004135.
RX PUBMED: 8065325.
RA Johansen F.-E., Prywes R.
RT Two pathways for serum regulation of the c-fos serum response element require specific sequence elements and a minimal domain of serum response factor
RL Mol. Cell. Biol. 14:5920-5928 (1994).
RN [36]; RE0004136.
RX PUBMED: 7957108.
RA Hill C. S., Wynne J., Treisman R.
RT Serum-regulated transcription by Serum Response Factor (SRF): a novel role for the DNA binding domain
RL EMBO J. 13:5421-5432 (1994).
RN [37]; RE0004137.
RX PUBMED: 7637780.
RA Pellegrini L., Tan S., Richmond T. J.
RT Structure of serum response factor core bound to DNA
RL Nature 376:490-498 (1995).
RN [38]; RE0004138.
RX PUBMED: 7799952.
RA Gauthier-Rouviere C., Vandromme M., Lautredou N., Cai Q. Q., Girard F., Fernandez A., Lamb N.
RT The serum response factor nuclear localization signal: general implications for cyclic AMP-dependent protein kinase activity in control of nuclear tanslocation
RL Mol. Cell. Biol. 15:433-444 (1995).
RN [39]; RE0004468.
RX PUBMED: 8668149.
RA Shore P., Whitmarsh A. J., Bhaskaran R., Davis R. J., Waltho J. P., Sharrocks A. D.
RT Determinants of DNA-binding specificity of ets-domain transcription factors
RL Mol. Cell. Biol. 16:3338-3349 (1996).
RN [40]; RE0005331.
RX PUBMED: 8164681.
RA Shore P., Sharrocks A. D.
RT The transcriptional factors Elk-1 and serum response factor interact by direct protein-protein contacts mediated by a short region of Elk-1
RL Mol. Cell. Biol. 14:3283-3291 (1994).
RN [41]; RE0006768.
RX PUBMED: 7565750.
RA Natesan S., Gilman M.
RT YY1 facilitates the association of serum response factor with the c-fos serum response element
RL Mol. Cell. Biol. 15:5975-5982 (1995).
RN [42]; RE0008678.
RX PUBMED: 8413226.
RA Rivera V. M., Miranti C. K., Misra R. P., Ginty D. D., Chen R. H., Blenis J., Greenberg M. E.
RT A growth factor-induced kinase phosphorylates the serum response factor at a site that regulates its DNA binding activity
RL Mol. Cell. Biol. 13:6260-6273 (1993).
RN [43]; RE0010523.
RX PUBMED: 7760827.
RA Grueneberg D. A., Simon K. J., Brennan K., Gilman M.
RT Sequence-specific targeting of nuclear signal transduction pathways by homeodomain proteins.
RL Mol. Cell. Biol. 15:3318-3326 (1995).
RN [44]; RE0015081.
RX PUBMED: 10960789.
RA Casero M., Sastre L.
RT A serum response factor homologue is expressed in ectodermal tissues during development of the crustacean Artemia franciscana
RL Mech. Dev. 96:229-232 (2000).
RN [45]; RE0015088.
RX PUBMED: 10318869.
RA Heidenreich O., Neininger A., Schratt G., Zinck R., Cahill M.A., Engel K., Kotlyarov A., Kraft R., Kostka S., Gaestel M., Nordheim A.
RT MAPKAP kinase 2 phosphorylates serum response factor in vitro and in vivo
RL J. Biol. Chem. 274:14434-14443 (1999).
RN [46]; RE0015279.
RX PUBMED: 3203386.
RA Norman C., Runswick M., Pollock R., Treisman R.
RT Isolation and properties of cDNA clones encoding SRF, a transcription factor that binds to the c-fos serum response element
RL Cell 55:989-1003 (1988).
RN [47]; RE0015298.
RX PUBMED: 8617811.
RA Groisman R., Masutani H., Leibovitch M. P., Robin P., Soudant I., Trouche D., Harel-Bellan A.
RT Physical interaction between the mitogen-responsive serum response factor and myogenic basic-helix-loop-helix proteins
RL J. Biol. Chem. 271:5258-5264 (1996).
RN [48]; RE0015299.
RX PUBMED: 9553110.
RA Ling Y., West A. G., Roberts E. C., Lakey J. H., Sharrocks A. D.
RT Interaction of transcription factors with serum response factor. Identification of the Elk-1 binding surface
RL J. Biol. Chem. 273:10506-10514 (1998).
RN [49]; RE0015302.
RX PUBMED: 9111360.
RA West A. G., Shore P., Sharrocks A. D.
RT DNA binding by MADS-box transcription factors: a molecular mechanism for differential DNA bending
RL Mol. Cell. Biol. 17:2876-2887 (1997).
RN [50]; RE0015323.
RX PUBMED: 8900044.
RA Chen C. Y., Croissant J., Majesky M., Topouzis S., McQuinn T., Frankovsky M. J., Schwartz R. J.
RT Activation of the cardiac alpha-actin promoter depends upon serum response factor, Tinman homologue, Nkx-2.5, and intact serum response elements
RL Dev. Genet. 19:119-130 (1996).
RN [51]; RE0015342.
RX PUBMED: 8193547.
RA Treisman R.
RT Ternary complex factors: growth factor regulated transcriptional activators
RL Curr. Opin. Gen. Dev. 4:96-101 (1994).
RN [52]; RE0015343.
RX PUBMED: 9171356.
RA Ling Y., Lakey J. H., Roberts C. E., Sharrocks A.D.
RT Molecular characterization of the B-box protein-protein interaction motif of the ETS-domain transcription factor Elk-1
RL EMBO J. 16:2431-2440 (1997).
RN [53]; RE0015389.
RX PUBMED: 10753652.
RA Fluck M., Booth F. W., Waxham M. N.
RT Skeletal muscle CaMKII enriches in nuclei and phosphorylates myogenic factor SRF at multiple sites
RL Biochem. Biophys. Res. Commun. 270:488-494 (2000).
RN [54]; RE0015398.
RX PUBMED: 1512232.
RA Reason A. J., Morris H. R., Panico M., Marais R., Treisman R. H., Haltiwanger R. S., Hart G. W., Kelly W. G., Dell A.
RT Localization of O-GlcNAc modification on the serum response transcription factor
RL J. Biol. Chem. 267:16911-16921 (1992).
RN [55]; RE0015489.
RX PUBMED: 8604338.
RA Magnaghi-Jaulin L., Masutani H., Robin P., Lipinski M., Harel-Bellan A.
RT SRE elements are binding sites for the fusion protein EWS-FLI-1
RL Nucleic Acids Res. 24:1052-1058 (1996).
RN [56]; RE0015517.
RX PUBMED: 8764983.
RA Magnaghi-Jaulin L., Masutani H., Lipinski M., Harel-Bellan A.
RT Analysis of SRF, SAP-1 and ELK-1 transcripts and proteins in human cell lines
RL FEBS Lett. 391:247-251 (1996).
RN [57]; RE0015521.
RX PUBMED: 10993896.
RA Carson J. A., Fillmore R. A., Schwartz R. J., Zimmer W. E.
RT The smooth muscle gamma -actin gene promoter is a molecular target for the mouse bagpipe homologue, mNkx3-1, and serum response factor
RL J. Biol. Chem. 275:39061-39072 (2000).
RN [58]; RE0015523.
RX PUBMED: 11003651.
RA Belaguli N. S., Sepulveda J. L., Nigam V., Charron F., Nemer M., Schwartz R. J.
RT Cardiac tissue enriched factors serum response factor and GATA-4 are mutual coregulators
RL Mol. Cell. Biol. 20:7550-7558 (2000).
RN [59]; RE0016089.
RX PUBMED: 11278942.
RA Herring B. P., Kriegel A. M., Hoggatt A. M.
RT Identification of Barx2b, a serum response factor-associated homeodomain protein.
RL J. Biol. Chem. 276:14482-14489 (2001).
RN [60]; RE0022791.
RX PUBMED: 10064699.
RA West A. G., Sharrocks A. D.
RT MADS-box transcription factors adopt alternative mechanisms for bending DNA.
RL J. Mol. Biol. 286:1311-1323 (1999).
RN [61]; RE0024084.
RX PUBMED: 12242287.
RA Murai K., Treisman R.
RT Interaction of serum response factor (SRF) with the Elk-1 B box inhibits RhoA-actin signaling to SRF and potentiates transcriptional activation by Elk-1.
RL Mol. Cell. Biol. 22:7083-7092 (2002).
RN [62]; RE0024126.
RX PUBMED: 9545312.
RA Chin M. T., Pellacani A., Wang H., Lin S. S., Jain M. K., Perrella M. A., Lee M. E.
RT Enhancement of serum-response factor-dependent transcription and DNA binding by the architectural transcription factor HMG-I(Y).
RL J. Biol. Chem. 273:9755-9760 (1998).
RN [63]; RE0024136.
RX PUBMED: 7630721.
RA Sharrocks A. D., Shore P.
RT DNA bending in the ternary nucleoprotein complex at the c-fos promoter.
RL Nucleic Acids Res. 23:2442-2449 (1995).
RN [64]; RE0024249.
RX PUBMED: 15014501.
RA Wang Z., Wang D. Z., Hockemeyer D., McAnally J., Nordheim A., Olson E. N.
RT Myocardin and ternary complex factors compete for SRF to control smooth muscle gene expression.
RL Nature 428:185-189 (2004).
RN [65]; RE0024258.
RX PUBMED: 11439182.
RA Wang D., Chang P. S., Wang Z., Sutherland L., Richardson J. A., Small E., Krieg P. A., Olson E. N.
RT Activation of cardiac gene expression by myocardin, a transcriptional cofactor for serum response factor.
RL Cell 105:851-862 (2001).
RN [66]; RE0024298.
RX PUBMED: 9880555.
RA Lehmann U., Brocke P., Dittmer J., Nordheim A.
RT Characterization of the human elk-1 promoter. Potential role of a downstream intronic sequence for elk-1 gene expression in monocytes.
RL J. Biol. Chem. 274:1736-1744 (1999).
RN [67]; RE0024587.
RX PUBMED: 10606656.
RA Dalgleish P., Sharrocks A. D.
RT The mechanism of complex formation between Fli-1 and SRF transcription factors.
RL Nucleic Acids Res. 28:560-569 (2000).
RN [68]; RE0024594.
RX PUBMED: 11406578.
RA Hassler M., Richmond T. J.
RT The B-box dominates SAP-1-SRF interactions in the structure of the ternary complex.
RL EMBO J. 20:3018-3028 (2001).
RN [69]; RE0025059.
RX PUBMED: 11136726.
RA Gupta M., Kogut P., Davis F. J., Belaguli N. S., Schwartz R. J., Gupta M. P.
RT Physical interaction between the MADS box of serum response factor and the TEA/ATTS DNA-binding domain of transcription enhancer factor-1.
RL J. Biol. Chem. 276:10413-10422 (2001).
RN [70]; RE0025060.
RX PUBMED: 11158291.
RA Morin S., Paradis P., Aries A., Nemer M.
RT Serum response factor-GATA ternary complex required for nuclear signaling by a G-protein-coupled receptor.
RL Mol. Cell. Biol. 21:1036-1044 (2001).
RN [71]; RE0025100.
RX PUBMED: 9171244.
RA Chen C. Y., Schwartz R. J.
RT Competition between negative acting YY1 versus positive acting serum response factor and tinman homologue Nkx-2.5 regulates cardiac alpha-actin promoter activity.
RL Mol. Endocrinol. 11:812-822 (1997).
RN [72]; RE0025147.
RX PUBMED: 8970984.
RA Chan Y. J., Chiou C. J., Huang Q., Hayward G. S.
RT Synergistic interactions between overlapping binding sites for the serum response factor and ELK-1 proteins mediate both basal enhancement and phorbol ester responsiveness of primate cytomegalovirus major immediate-early promoters in monocyte and T-lymphocyte cell types.
RL J. Virol. 70:8590-8605 (1996).
RN [73]; RE0025209.
RX PUBMED: 10318842.
RA Hanlon M., Sealy L.
RT Ras regulates the association of serum response factor and CCAAT/enhancer-binding protein beta.
RL J. Biol. Chem. 274:14224-14228 (1999).
RN [74]; RE0025229.
RX PUBMED: 8614640.
RA Latinkic B. V., Zeremski M., Lau L. F.
RT Elk-1 can recruit SRF to form a ternary complex upon the serum response element.
RL Nucleic Acids Res. 24:1345-1351 (1996).
RN [75]; RE0027715.
RX PUBMED: 10571058.
RA Yamada K., Osawa H., Granner D. K.
RT Identification of proteins that interact with NF-YA.
RL FEBS Lett. 460:41-5 (1999).
RN [76]; RE0032980.
RX PUBMED: 12788062.
RA Matsuzaki K., Minami T., Tojo M., Honda Y., Uchimura Y., Saitoh H., Yasuda H., Nagahiro S., Saya H., Nakao M.
RT Serum response factor is modulated by the SUMO-1 conjugation system.
RL Biochem. Biophys. Res. Commun. 306:32-8 (2003).
RN [77]; RE0047857.
RX PUBMED: 15492011.
RA Zhang X., Azhar G., Zhong Y., Wei J. Y.
RT Identification of a novel serum response factor cofactor in cardiac gene regulation.
RL J. Biol. Chem. 279:55626-55632 (2004).
RN [78]; RE0047866.
RX PUBMED: 16135793.
RA Kawai-Kowase K., Kumar M. S., Hoofnagle M. H., Yoshida T., Owens G. K.
RT PIAS1 activates the expression of smooth muscle cell differentiation marker genes by interacting with serum response factor and class I basic helix-loop-helix proteins.
RL Mol. Cell. Biol. 25:8009-8023 (2005).
RN [79]; RE0062639.
RX PUBMED: 18296735.
RA Zhang Y., Fillmore R. A., Zimmer W. E.
RT Structural and functional analysis of domains mediating interaction between the bagpipe homologue, Nkx3.1 and serum response factor.
RL Exp. Biol. Med. (Maywood) 233:297-309 (2008).
RN [80]; RE0066629.
RX PUBMED: 15550397.
RA Yin F., Herring B. P.
RT GATA-6 can act as a positive or negative regulator of smooth muscle-specific gene expression.
RL J. Biol. Chem. 280:4745-4752 (2005).
RN [81]; RE0070149.
RX PUBMED: 21098124.
RA Mylona A., Nicolas R., Maurice D., Sargent M., Tuil D., Daegelen D., Treisman R., Costello P.
RT The essential function for serum response factor in T-cell development reflects its specific coupling to extracellular signal-regulated kinase signaling.
RL Mol. Cell. Biol. 31:267-276 (2011).
RN [82]; RE0002914.
RX PUBMED: 1396566.
RA Denny P., Swift S., Connor F., Ashworth A.
RT An SRY-related gene expressed during spermatogenesis in the mouse encodes a sequence-specific DNA-binding protein
RL EMBO J. 11:3705-3712 (1992).
XX
//