TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T04255 XX ID T04255 XX DT 26.01.2001 (created); rio. DT 28.02.2012 (updated); grs. CO Copyright (C), QIAGEN. XX FA NKX3A XX SY Nkx-3.1; NKX3.1; NKX3A. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G004029 NKX3-1; HGNC: NKX3-1. XX HO NK-3 T03612 Drosophila. XX CL C0006; homeo; 3.1.2.16.1.1. XX SZ 234 AA; 26.2 kDa (cDNA) (calc.). XX SQ MLRVPEPRPGEAKAEGAAPPTPSKPLTSFLIQDILRDGAQRQGGRTSSQRQRDPEPEPEP SQ EPEGGRSRAGAQNDQLSTGPRAAPEEAETLAETEPERHLGSYLLDSENTSGALPRLPQTP SQ KQPQKRSRAAFSHTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKTK SQ RKQLSSELGDLEKHSSLPALKEEAFSRASLVSVYNSYPYYPYLYCVGSWSPAFG XX SC translated from EMBL #U91540 XX FT 122 182 PS50071; HOMEOBOX_2. FT 124 186 SM00389; HOX_1. FT 125 181 PF00046; Homeobox domain. XX SF 78% homeo domain identity to NK-3/Tinman T03612 of Drosophila [1]; SF androgen responsive expression [1]; SF androgens and estradiol but not progesterone can increase expression [2]; SF at least 5 different splice variants: NKX3A T04255, NKX3A v1T04287, NKX3A v2 T04288, NKX3A v3 T04289 and NKX3A v4 T04290 [2]; SF untypical TAAGTA binding consensus that has not been reported for any other NK class homeodomain factor [3]; XX CP (cell lines:) LNCaP [1]. CN (cell lines:) PC3, DU-145, FS4, HuPBL, DAOY, BHM22, 8392, HeLa, SW480, RT-4, HTB-44, OVCAR-3, CATES-1B [1]. EX colon,,,adult; none; Northern blot; mRNA (poly-A); [1]. EX ovary (right and left),,,adult; none; Northern blot; mRNA (poly-A); [1]. EX prostate gland,,,adult; detectable; Northern blot; mRNA (poly-A); [1]. EX small intestine,,,adult; none; Northern blot; mRNA (poly-A); [1]. EX spleen,,,adult; none; Northern blot; mRNA (poly-A); [1]. EX testis (right and left),,,adult; low; Northern blot; mRNA (poly-A); [1]. EX thymus,,,adult; none; Northern blot; mRNA (poly-A); [1]. XX FF involved in androgen-driven differentiation of prostatic tissue [1]; FF may have important regulatory roles during prostate cancer progression [2]; FF transcriptional repressor [3]; XX IN T09343 SRF; human, Homo sapiens. XX MX M00451 V$NKX3A_01. MX M01383 V$NKX3A_02. MX M03833 V$NKX3A_Q3. XX BS R10331. BS R10332. BS R10333. BS R10334. BS R10335. BS R10336. BS R10337. BS R10338. BS R10339. BS R10340. BS R10341. BS R10342. BS R10343. BS R10344. BS R10345. BS R10346. BS R10347. BS R10348. BS R10349. XX DR TRANSPATH: MO000028121. DR EMBL: U91540; DR UniProtKB: Q99801-1; XX RN [1]; RE0015663. RX PUBMED: 9226374. RA He W. W., Sciavolino P. J., Wing J., Augustus M., Hudson P., Meissner P. S., Curtis R. T., Shell B. K., Bostwick D. G., Tindall D. J., Gelmann E. P., Abate-Shen C., Carter K. C. RT A novel human prostate-specific, androgen-regulated homeobox gene (NKX3.1) that maps to 8p21, a region frequently deleted in prostate cancer RL Genomics 43:69-77 (1997). RN [2]; RE0015706. RX PUBMED: 11137288. RA Korkmaz K. S., Korkmaz C. G., Ragnhildstveit E., Kizildag S., Pretlow T. G., Saatcioglu F. RT Full-length cDNA sequence and genomic organization of human NKX3A - alternative forms and regulation by both androgens and estrogens RL Gene 260:25-36 (2000). RN [3]; RE0016763. RX PUBMED: 10871372. RA Steadman D. J., Giuffrida D., Gelmann E. P. RT DNA-binding sequence of the human prostate-specific homeodomain protein NKX3.1 RL Nucleic Acids Res. 28:2389-2395 (2000). RN [4]; RE0062639. RX PUBMED: 18296735. RA Zhang Y., Fillmore R. A., Zimmer W. E. RT Structural and functional analysis of domains mediating interaction between the bagpipe homologue, Nkx3.1 and serum response factor. RL Exp. Biol. Med. (Maywood) 233:297-309 (2008). XX //