TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T09948 XX ID T09948 XX DT 23.11.2006 (created); kau. DT 07.12.2006 (updated); kau. CO Copyright (C), QIAGEN. XX FA BF-1 XX SY BF-1; brain factor 1; c-Qin. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G009113 Foxg1. XX CL C0023; fork head. XX SZ 481 AA; 51.6 kDa (cDNA) (calc.), 51.6 kDa (cDNA) [4] XX SQ MLDMGDRKEVKMIPKSSFSINSLVPEAVQNDNHHASHGHHNSHHPQHHHHHHHHHHPPPP SQ APQPPPPPPQQQQQQPPPAPQPPQARGAPAADDDKGPQPLLLPPSTALDGAKADALGAKG SQ EPGGGPAELAPVGPDEKEKGAGAGGEEKKGAGEGGKDGEGGKEGDKKNGKYEKPPFSYNA SQ LIMMAIRQSPEKRLTLNGIYEFIMKNFPYYRENKQGWQNSIRHNLSLNKCFVKVPRHYDD SQ PGKGNYWMLDPSSDDVFIGGTTGKLRRRSTTSRAKLAFKRGARLTSTGLTFMDRAGSLYW SQ PMSPFLSLHHPRASSTLSYNGTTSAYPSHPMPYSSVLTQNSLGNNHSFSTANGLSVDRLV SQ NGEIPYATHHLTAAALAASVPCGLSVPCSGTYSLNPCSVNLLAGQTSYFFPHVPHPSMTS SQ QTSTSMSARAASSSTSPQAPSTLPCESLRPSLPSFTTGLSGGLSDYFTHQNQGSSSNPLI SQ H XX SC Swiss-Prot#Q60987 XX FT 3 479 PF00478; IMP dehydrogenase / GMP reductase domain. FT 171 261 SM00339; forkneu4. FT 172 263 fork head homology [4]. FT 173 267 PS50039; FORK_HEAD_3. FT 173 268 PF00250; Fork head domain. FT 276 336 interaction with TLE1 [8]. FT 276 372 interaction with FAST-2 [10]. FT 299 309 conserved between different species [8]. XX IN T21852 HDAC1; Mammalia. IN T09897 HES-1; rat, Rattus norvegicus. XX DR TRANSPATH: MO000093129. DR UniProtKB: Q60987; BF1_MOUSE. XX RN [1]; RE0006641. RX PUBMED: 7815060. RA Hatini V., Lao W., Lai E. RT Expression of Winged Helix Genes, BF-1 and BF-2, Define Adjacent Domains within the Developing Forbrain and Retina RL J. Neurobiol. 25:1293-1309 (1994). RN [2]; RE0006645. RX PUBMED: 7789972. RA Avraham K. B., Fletcher C., Overdier D. G., Clevidence D. E., Lai E., Costa R. H., Jenkins N. A., Copeland N. G. RT Murine Chromosomal Location of Eight Members of the Hepatocyte Nuclear Factor 3/Fork Head Winged Helix Family of Transcription Factors RL Genomics 25:388-393 (1995). RN [3]; RE0006646. RX PUBMED: 7605629. RA Xuan S., Baptista C. A., Balas G., Tao W., Soares V. C., Lai E. RT Winged Helix Transcription Factor BF-1 is Essential for the Development of the Crebral Hemispheres RL Neuron 14:1141-1152 (1995). RN [4]; RE0006647. RX PUBMED: 8738140. RA Li H., Tao W., Lai E. RT Characterization of the structure and function of the gene for transcription factor BF-1, an essential regulator of forebrain development RL Mol. Brain Res. 37:96-104 (1996). RN [5]; RE0006697. RX PUBMED: 9226442. RA Shimamura K., Rubenstein J. L. R. RT Inductive interactions direct early regionalization of the mouse forebrain RL Development 124:2709-2718 (1997). RN [6]; RE0023704. RX PUBMED: 12351726. RA Pratt T., Quinn J. C., Simpson T. I., West J. D., Mason J. O., Price D. J. RT Disruption of early events in thalamocortical tract formation in mice lacking the transcription factors Pax6 or Foxg1. RL J. Neurosci. 22:8523-8531 (2002). RN [7]; RE0023705. RX PUBMED: 14704420. RA Hanashima C., Li S. C., Shen L., Lai E., Fishell G. RT Foxg1 suppresses early cortical cell fate. RL Science 303:56-59 (2004). RN [8]; RE0023713. RX PUBMED: 11238932. RA Yao J., Lai E., Stifani S. RT The winged-helix protein brain factor 1 interacts with groucho and hes proteins to repress transcription. RL Mol. Cell. Biol. 21:1962-1972 (2001). RN [9]; RE0023714. RX PUBMED: 11387330. RA Rodriguez C., Huang L. J., Son J. K., McKee A., Xiao Z., Lodish H. F. RT Functional cloning of the proto-oncogene brain factor-1 (BF-1) as a Smad-binding antagonist of transforming growth factor-beta signaling. RL J. Biol. Chem. 276:30224-30230 (2001). RN [10]; RE0023715. RX PUBMED: 10938097. RA Dou C., Lee J., Liu B., Liu F., Massague J., Xuan S., Lai E. RT BF-1 interferes with transforming growth factor beta signaling by associating with Smad partners. RL Mol. Cell. Biol. 20:6201-6211 (2000). RN [11]; RE0048295. RX PUBMED: 16691564. RA Pauley S., Lai E., Fritzsch B. RT Foxg1 is required for morphogenesis and histogenesis of the mammalian inner ear. RL Dev. Dyn. 235:2470-2482 (2006). RN [12]; RE0048296. RX PUBMED: 15893304. RA Martynoga B., Morrison H., Price D. J., Mason J. O. RT Foxg1 is required for specification of ventral telencephalon and region-specific regulation of dorsal telencephalic precursor proliferation and apoptosis. RL Dev. Biol. 283:113-127 (2005). RN [13]; RE0048298. RX PUBMED: 15858069. RA Muzio L., Mallamaci A. RT Foxg1 confines Cajal-Retzius neuronogenesis and hippocampal morphogenesis to the dorsomedial pallium. RL J. Neurosci. 25:4435-4441 (2005). XX //