AC T00151
AS T00474, T01204.
XX
ID T00151
XX
DT 15.10.1992 (created); ewi.
DT 24.05.2012 (updated); din.
CO Copyright (C), QIAGEN.
XX
FA CP2-isoform1
XX
SY alpha-CP2; alpha-CP2a; CP-2; Late SV40 factor; LBP-1c; LSF; SEF; TFCP2.
XX
OS human, Homo sapiens
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates
XX
GE G004959 TFCP2; HGNC: TFCP2.
XX
HO Elf-1 (Drosophila) T01019.
XX
CL C0051; Grainyhead; 6.7.2.0.1.1.
XX
SZ 502 AA; 57.3 kDa (calc.).
XX
SQ MAWALKLPLADEVIESGLVQDFDASLSGIGQELGAGAYSMSDVLALPIFKQEESSLPPDN
SQ ENKILPFQYVLCAATSPAVKLHDETLTYLNQGQSYEIRMLDNRKLGELPEINGKLVKSIF
SQ RVVFHDRRLQYTEHQQLEGWRWNRPGDRILDIDIPMSVGIIDPRANPTQLNTVEFLWDPA
SQ KRTSVFIQVHCISTEFTMRKHGGEKGVPFRVQIDTFKENENGEYTEHLHSASCQIKVFKP
SQ KGADRKQKTDREKMEKRTPHEKEKYQPSYETTILTECSPWPEITYVNNSPSPGFNSSHSS
SQ FSLGEGNGSPNHQPEPPPPVTDNLLPTTTPQEAQQWLHRNRFSTFTRLFTNFSGADLLKL
SQ TRDDVIQICGPADGIRLFNALKGRMVRPRLTIYVCQESLQLREQQQQQQQQQQKHEDGDS
SQ NGTFFVYHAIYLEELTAVELTEKIAQLFSISPCQISQIYKQGPTGIHVLISDEMIQNFQE
SQ EACFILDTMKQETNDSYHIILK
XX
SC translated from edited EMBL entry #U03494
XX
FT 37 264 
PF04516; CP2 transcription factor.
FT 65 210 
additional region for oligomerization [16].
FT 168 498 
PF00478; IMP dehydrogenase / GMP reductase domain.
FT 234 320 
DNA binding [16].
FT 266 403 
core oligomerization region [16].
FT 384 502 
additional part for optimal DNA binding [16].
FT 404 502 
additional region for oligomerization [16].
XX
SF binds to DNA as a homotetramer, in solution is primarily a dimer [16];
SF belongs to the Granyhead-like family of TFs, together with Drosophila Elf-1/NTF-1 factors, and likely presents novel type of DNA binding [16];
SF recognizes DNA elements consisting of two directly repeated half-sites [16] [13];
SF splice-variant is LBP-1d T05680 [13];
XX
CP (HeLa).
XX
FF activator;
FF activates transcription of SV40 late promoter [5];
FF genetic determinant of Alzheimer's disease [15];
FF biallelic polymorphism, A->G, influences the risk of AD [15];
XX
IN T08291 GATA-1-isoform1; mouse, Mus musculus.
IN T00759 Sp1; human, Homo sapiens.
XX
MX M00072 V$CP2_01.
MX M00947 V$CP2_02.
MX M07602 V$CP2_Q4.
MX M03868 V$CP2_Q6.
XX
BS R14309.
BS R04132.
BS R00571.
BS R16609.
BS R02195.
BS R23028.
BS R23023.
BS R23030.
BS R01373.
BS R01374.
BS R01421.
XX
DR TRANSPATH: MO000024738.
DR TRANSCOMPEL: C00338.
DR EMBL: M84810;
DR EMBL: U01965;
DR EMBL: U03494;
DR UniProtKB: Q12800-1;
XX
RN [1]; RE0000036.
RX PUBMED: 3349524.
RA Chodosh L. A., Baldwin jr A. S., Carthew R. W., Sharp P. A.
RT Human CCAAT-Binding Proteins Have Heterologous Subunits
RL Cell 53:11-24 (1988).
RN [2]; RE0000037.
RX PUBMED: 3280141.
RA Chodosh L. A., Olesen J., Hahn S., Baldwin jr A. S., Guarente L., Sharp P. A.
RT A Yeast and a Human CCAAT-Binding Protein Have Heterologous Subunits That Are Functionally Interchangeable
RL Cell 53:25-35 (1988).
RN [3]; RE0000447.
RX PUBMED: 1698608.
RA Hooft van Huijsduijnen R., Li X. Y., Black D., Matthes H., Benoist C., Mathis D.
RT Co-evolution from yeast to mouse: cDNA cloning of the two NF-Y (CP-1/CBF) subunits
RL EMBO J. 9:3119-3127 (1990).
RN [4]; RE0000618.
RX PUBMED: 2159932.
RA Dutta A., Stoeckle M. Y., Hanafusa H.
RT Serum and v-src increase the level of a CCAAT-binding factor required for transcription from a retroviral long terminal repeat
RL Genes Dev. 4:243-254 (1990).
RN [5]; RE0000682.
RX PUBMED: 2159933.
RA Huang H.-C., Sundseth R., Hansen U.
RT Transcription factor LSF binds two variant bipartite sites within the SV40 late promoter
RL Genes Dev. 4:287-298 (1990).
RN [6]; RE0001257.
RX PUBMED: 2905426.
RA Barnhart K. M., Kim C. G., Banerji S. S., Sheffery M.
RT Identification and Characterization of Multiple Erythroid Cell Proteins That Interact with the Promoter of the Murine alpha-Globin Gene
RL Mol. Cell. Biol. 8:3215-3226 (1988).
RN [7]; RE0001633.
RX PUBMED: 1732747.
RA Lim L. C., Swendeman S. L., Sheffery M.
RT Molecular cloning of the alpha-globin transcription factor CP2
RL Mol. Cell. Biol. 12:828-835 (1992).
RN [8]; RE0002348.
RX PUBMED: 2819862.
RA Kim C. H., Heath C., Bertuch A., Hansen U.
RT Specific stimulation of simian virus 40 late transcription in vitro by a cellular factor binding the simian virus 40 21-base-pair repeat promoter element
RL Proc. Natl. Acad. Sci. USA 84:6025-6029 (1987).
RN [9]; RE0002945.
RX PUBMED: 2233727.
RA Kim C. G., Swendeman S. L., Barnhart K. M., Sheffery M.
RT Promoter elements and erythroid cell nuclear factors that regulate alpha-globin gene transcription in vitro
RL Mol. Cell. Biol. 10:5958-5966 (1990).
RN [10]; RE0003046.
RX PUBMED: 7828600.
RA Jane S. M., Nienhuis A. W., Cunningham J. M.
RT Hemoglobin switching in man and chicken is mediated by a heteromeric complex between the ubiquitous transcription factor CP2 and a developmentally specific protein
RL EMBO J. 14:97-105 (1995).
RN [11]; RE0003518.
RX PUBMED: 8114710.
RA Yoon J. B., Li G., Roeder R. G.
RT Characterization of a family of related cellular transcription factors which can modulate human immunodeficiency virus type 1 trancription in vitro
RL Mol. Cell. Biol. 14:1776-1785 (1994).
RN [12]; RE0008932.
RX PUBMED: 8157699.
RA Swendeman S. L., Spielholz C., Jenkins N. A., Gilbert D. J., Copeland N. G., Sheffery M.
RT Characterization of the genomic structure, chromosomal location, promoter and developmental expression of the alpha-globin transcription factor CP2
RL J. Biol. Chem. 269:11663-11671 (1994).
RN [13]; RE0009620.
RX PUBMED: 8035790.
RA Shirra M. K., Zhu Q., Huang H.-C., Pallas D., Hansen U.
RT One exon of the human LSF gene includes conserved regions involved in novel DNA-binding and dimerization motifs
RL Mol. Cell. Biol. 14:5076-5087 (1994).
RN [14]; RE0017867.
RX PUBMED: 11673232.
RA Frith M. C., Hansen U., Weng Z.
RT Detection of cis-element clusters in higher eukaryotic DNA
RL Bioinformatics 17:878-889 (2001).
RN [15]; RE0023308.
RX PUBMED: 11001930.
RA Lambert J. C., Goumidi L., Vrieze F. W., Frigard B., Harris J. M., Cummings A., Coates J., Pasquier F., Cottel D., Gaillac M., St Clair D., Mann D. M., Hardy J., Lendon C. L., Amouyel P., Chartier-Harlin M. C.
RT The transcriptional factor LBP-1c/CP2/LSF gene on chromosome 12 is a genetic determinant of Alzheimer's disease.
RL Hum. Mol. Genet. 9:2275-2280 (2000).
RN [16]; RE0023309.
RX PUBMED: 9668115.
RA Shirra M. K., Hansen U.
RT LSF and NTF-1 share a conserved DNA recognition motif yet require different oligomerization states to form a stable protein-DNA complex.
RL J. Biol. Chem. 273:19260-19268 (1998).
RN [17]; RE0023445.
RX PUBMED: 12888489.
RA Venkatesan K., McManus H. R., Mello C. C., Smith T. F., Hansen U.
RT Functional conservation between members of an ancient duplicated transcription factor family, LSF/Grainyhead.
RL Nucleic Acids Res. 31:4304-4316 (2003).
XX
//