TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T00810 XX ID T00810 XX DT 27.01.1993 (created); hse. DT 31.03.2009 (updated); ane. CO Copyright (C), QIAGEN. XX FA TFEA-xbb2 XX SY TFE3. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G006798 Tfe3. XX CL C0012; bHLH-ZIP. XX SZ 446 AA; 47.9 kDa (cDNA) (calc.). XX SQ TSGTRRREQAAAAPFPSPAPASPAISVIGVSAGGHTLSRPPPAQVPREVLKVQTHLENPT SQ RYHLQQARRQQVKQYLSTTLGPKLASQALTPPPGPSSAQPLPAPETAHATGPTGSAPNSP SQ MALLTIGSSSEKEIDDVIDEIISLESSYNDEMLSYLPGGTAGLQLPSTLPVSGNLLDVYS SQ SQGVATPAITVSNSCPAELPNIKREISETEAKALLKERQKKDNHNLIERRRRFNINDRIK SQ ELGTLIPKSNDPEMRWNKGTILKASVDYIRKLQKEQQRSKDLESRQRSLEQANRSLQLRI SQ QELELQAQIHGLPVPPNPGLLSLTTSSVSDSLKPEQLDIEEEGRPSTTFHVSGGPAQNAP SQ PQQPPAPPSDALLDLHFPSDHLGDLGDPFHLGLEDILMEEEGMVGGLSGGALSPLRAASD SQ PLLSSVSPAVSNASSRRSSFSIEEES XX SC translated from EMBL #S76673 XX FT 7 310 PF00478; IMP dehydrogenase / GMP reductase domain. FT 121 206 N-terminal trans-activating region [5]. FT 134 168 missing in splice variant TFE3-S [2]. FT 217 273 PS50888; HLH. FT 220 273 PF00010; Helix-loop-helix DNA-binding domain. FT 225 278 SM00353; finulus. FT 345 446 C-terminal trans-activating region [5]. XX SF the leucine zipper contributes to dimerization specificity [3] [4]; SF tetramers are formed free in solution [4]; SF TFE3 molecules remotely bound to enhancer/promoter elements which may thus interact; XX FF TFEA-xbb2 is an approximately 3-fold stronger activator than TFE3-S [2]; FF cooperating with ITF-1, TFE3 can mediate lymphoid-specific activation through combined elements (such as muE5 and muE3 in the IgH enhancer) [1]; XX IN T02947 E2F-3A; mouse, Mus musculus. IN T00814 TFEA-xbb1; mouse, Mus musculus. IN T00810 TFEA-xbb2; mouse, Mus musculus. IN T00812 tfeb-isoform1; human, Homo sapiens. XX MX M01034 V$EBOX_Q6_01. MX M03890 V$TFEA_Q6. MX M01029 V$TFE_Q6. XX BS R15203. BS R00853. BS R15851. BS R15422. BS R15425. BS R15421. BS R15424. BS R02252. XX DR TRANSPATH: MO000025186. DR TRANSCOMPEL: C00170. DR TRANSCOMPEL: C00253. DR TRANSCOMPEL: C00261. DR TRANSCOMPEL: C00427. DR EMBL: S76673; XX RN [1]; RE0000670. RX PUBMED: 1899229. RA Ruezinsky D., Beckmann H., Kadesh T. RT Modulation of the Igh enhancer's cell type through a genetic switch RL Genes Dev. 5:29-37 (1991). RN [2]; RE0002659. RX PUBMED: 1840705. RA Roman C., Cohn L., Calame K. RT A dominant negative form of transcription activator mTFE3 created by differential splicing RL Science 254:94-97 (1991). RN [3]; RE0003076. RX PUBMED: 1732746. RA Roman C., Matera A. G., Cooper C., Artandi S., Blain S., Ward D. C., Calame K. RT mTFE3, an X-linked transcriptional activator containing basic helix-loop-helix and zipper domains, utilizes the zipper to stabilize both DNA binding and multimerization RL Mol. Cell. Biol. 12:817-827 (1992). RN [4]; RE0003419. RX PUBMED: 7969114. RA Artandi S. E., Cooper C., Shrivastava A., Calame K. RT The basic helix-loop-helix-zipper domain of TFE3 mediates enhancer-promoter interaction RL Mol. Cell. Biol. 14:7704-7716 (1994). RN [5]; RE0006694. RX PUBMED: 7479029. RA Artandi S. E., Merrell K., Avtiahl N., Wong K.-K., Calame K. RT TFE3 contains two activation domains, one acidic and the other proline-rich, that synergistically activate transcription RL Nucleic Acids Res. 23:3865-3871 (1995). XX //