TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T00812 XX ID T00812 XX DT 20.10.1992 (created); ewi. DT 13.03.2014 (updated); spk. CO Copyright (C), QIAGEN. XX FA tfeb-isoform1 XX SY TFEB; transcription factor EB. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G004670 TFEB; HGNC: TFEB. XX CL C0012; bHLH-ZIP; 1.2.6.1.2.1. XX SZ 476 AA; 52.9 kDa (calc.). XX SQ MASRIGLRMQLMREQAQQEEQRERMQQQAVMHYMQQQQQQQQQQLGGPPTPAINTPVHFQ SQ SPPPVPGEVLKVQSYLENPTSYHLQQSQHQKVREYLSETYGNKFAAHISPAQGSPKPPPA SQ ASPGVRAGHVLSSSAGNSAPNSPMAMLHIGSNPERELDDVIDNIMRLDDVLGYINPEMQM SQ PNTLPLSSSHLNVYSSDPQVTASLVGVTSSSCPADLTQKRELTDAESRALAKERQKKDNH SQ NLIERRRRFNINDRIKELGMLIPKANDLDVRWNKGTILKASVDYIRRMQKDLQKSRELEN SQ HSRRLEMTNKQLWLRIQELEMQARVHGLPTTSPSGMNMAELAQQVVKQELPSEEGPGEAL SQ MLGAEVPDPEPLPALPPQAPLPLPTQPPSPFHHLDFSHSLSFGGREDEGPPGYPEPLAPG SQ HGSPFPSLSKKDLDLMLLDDSLLPLASDPLLSTMSPEASKASSRRSSFSMEEGDVL XX SC translated from EMBL #AL035588 XX FT 233 289 PS50888; HLH. FT 236 289 PF00010; Helix-loop-helix DNA-binding domain. FT 241 294 SM00353; finulus. XX SF tfeb-isoform1 is closely related to TFE3; SF leucine zipper: essential for dimerization [1]; SF free in solution: tetramerization [1]; SF induces DNA bending towards the minor groove to 74-82 deg [4]; SF basic region becomes alpha-helically folded upon binding to DNA (CD) [5]; SF K334, H337, E340, R343: critical for DNA-binding [5]; SF C-terminal part of basic region: clamp, forming phosphate contacts across the major groove framing a base pair contact [5]; XX CP transcripts detected in all tissues examined, but with large variations in expression levels between different transcripts and different tissues [6]. XX FF increased tfeb-isoform1 expression due to promoter substitution (chromosomal translocation t(6; FF 11)(p21; FF q13)) in a subgroup of renal cell carcinomas [7]; XX IN T01553 MITF; human, Homo sapiens. IN T01554 MITF; mouse, Mus musculus. IN T00814 TFEA-xbb1; mouse, Mus musculus. IN T00810 TFEA-xbb2; mouse, Mus musculus. IN T00811 TFEA; human, Homo sapiens. IN T00812 tfeb-isoform1; human, Homo sapiens. XX MX M01034 V$EBOX_Q6_01. MX M01029 V$TFE_Q6. XX BS R00992. BS R02094. BS R03231. BS R03232. BS R03233. BS R02253. XX DR TRANSPATH: MO000025188. DR EMBL: AL035588; AL035588. DR EMBL: M33782; DR UniProtKB: P19484-1; XX RN [1]; RE0000699. RX PUBMED: 1748288. RA Fisher D. E., Carr C. S., Parent L. A., Sharp P. A. RT TFEB has DNA-binding and oligomerization properties of a unique helix-loop-helix/leucine zipper family RL Genes Dev. 5:2342-2352 (1991). RN [2]; RE0001449. RX PUBMED: 2115126. RA Carr C. S., Sharp Ph. A. RT A Helix-Loop-Helix Protein Related to the Immunoglobulin E Box-Binding Proteins RL Mol. Cell. Biol. 10:4384-4388 (1990). RN [3]; RE0002511. RX PUBMED: 2068097. RA Halazonetis T. D., Kandil A. N. RT Determination of the C-MYC DNA-binding site RL Proc. Natl. Acad. Sci. USA 88:6162-6166 (1991). RN [4]; RE0003338. RX PUBMED: 1465398. RA Fisher D. E., Parent L. A., Sharp P. A. RT Myc/Max and other helix-loop-helix/leucine zipper proteins bend DNA toward the minor groove RL Proc. Natl. Acad. Sci. USA 89:11779-11783 (1992). RN [5]; RE0003420. RX PUBMED: 8431949. RA Fisher D. E., Parent L. A., Sharp P. A. RT High affinity DNA-binding Myc analogs: recognition by an alpha helix RL Cell 72:467-476 (1993). RN [6]; RE0025424. RX PUBMED: 15118077. RA Kuiper R. P., Schepens M., Thijssen J., Schoenmakers E. F., van Kessel A. G. RT Regulation of the MiTF/TFE bHLH-LZ transcription factors through restricted spatial expression and alternative splicing of functional domains. RL Nucleic Acids Res. 32:2315-2322 (2004). RN [7]; RE0025433. RX PUBMED: 12837690. RA Kuiper R. P., Schepens M., Thijssen J., van Asseldonk M., van den Berg E., Bridge J., Schuuring E., Schoenmakers E. F., van Kessel A. G. RT Upregulation of the transcription factor TFEB in t(6;11)(p21;q13)-positive renal cell carcinomas due to promoter substitution. RL Hum. Mol. Genet. 12:1661-1669 (2003). XX //