AC T00893
XX
ID T00893
XX
DT 15.10.1992 (created); ewi.
DT 11.02.2014 (updated); jtr.
CO Copyright (C), QIAGEN.
XX
FA v-Jun
XX
SY v-Jun.
XX
OS ASV 17, avian sarcoma virus 17
OC viridae; ss-RNA enveloped viruses; positive strand RNA viruses; retroviridae; oncovirinae; type C oncovirus group; avian type C oncoviruses; avian sarcoma viruses
XX
CL C0008; bZIP.
XX
SZ 296 AA; 32.5 kDa (gene) (calc.), 65 kDa (SDS)
XX
SQ VPPLRGLCSMSAKMEPTFYEDALNASFAPPESGGYGYNNADILTSPDVGLLKLASPELER
SQ LIIQSSNGLITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHNQNTLPSVTSAAQPVS
SQ GGMAPVSSMAGGGSFNTSLHSEPPVYANLSNFNPNALNSAPNYNANRMGYAPQHHINPQM
SQ PVQHPRLQALKEEPQTVPEMPGETPPLFPIDMESQERIKAERKRMRNRIAASKSRKRKLE
SQ RIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
XX
SC Swiss-Prot#P05411
XX
FT 14 206 
PF03957; Jun-like transcription factor.
FT 215 279 
PF00170; bZIP transcription factor.
FT 215 279 
SM00338; brlzneu.
FT 217 280 
PS50217; BZIP.
XX
SF the given experimental molecular mass refers to the viral oncogene fusion product gag-jun which v-Jun is part of;
SF the suggested trans-activation domain is nearly identical with that of c-Jun (21/22 amino acid residues) [2];
XX
FF strong activator [2] [3];
FF activation by v-Jun depends on additional cell-specific components [10];
FF causes neoplastic transformation of chicken fibroblasts and induces fibrosarcomas [7] [9];
FF in contrast to c-Jun, a Cys to Ser substitution immediately N-terminal to the nuclear translocation signal causes nuclear translocation to occur in a cell cycle-dependent manner [11];
XX
IN T00123 c-Fos; human, Homo sapiens.
IN T00124 c-Fos; rat, Rattus norvegicus.
IN T00893 v-Jun; ASV 17, avian sarcoma virus 17.
IN T01430 v-Maf; AS42, avian musculoaponeurotic fibrosarcoma virus.
XX
MX M00036 V$VJUN_01.
XX
BS R05629.
BS R05630.
BS R05631.
BS R05632.
BS R05633.
BS R05634.
BS R05635.
BS R05636.
BS R05637.
BS R05638.
BS R05639.
BS R05640.
BS R05641.
BS R05642.
BS R05643.
BS R05644.
BS R05645.
BS R05646.
BS R05647.
BS R05648.
BS R05649.
BS R05650.
BS R05651.
BS R05652.
BS R04116.
BS R00678.
BS R00235.
BS R01037.
BS R60235.
BS R01384.
BS R01394.
BS R01412.
BS R04648.
XX
DR TRANSPATH: MO000013700.
DR EMBL: M16266;
DR UniProtKB: P05411;
XX
RN [1]; RE0000123.
RX PUBMED: 2830989.
RA Bos T. J., Bohmann D., Tsuchie H., Tjian R., Vogt P. K.
RT v-jun encodes a nuclear protein with enhancer binding properties of AP-1
RL Cell 52:705-712 (1988).
RN [2]; RE0000124.
RX PUBMED: 2510934.
RA Bohmann D., Tjian R.
RT Biochemical analysis of transcriptional activation by Jun: Differential activity of c- and v-Jun
RL Cell 59:709-717 (1989).
RN [3]; RE0001772.
RX PUBMED: 3347253.
RA Angel P., Allegretto E. A., Okino S. T., Hattori K., Boyle W. J., Hunter T., Karin M.
RT Oncogene jun encodes a sequence-specific trans-activator similar to AP-1
RL Nature 332:166-171 (1988).
RN [4]; RE0002299.
RX PUBMED: 2492109.
RA Sharma A., Bos T. J., Pekkala-Flagan A., Vogt P. K., Lee A. S.
RT Interaction of cellular factors related to the Jun oncoprotein with the promoter of a replication-dependent hamster histone H3.2 gene
RL Proc. Natl. Acad. Sci. USA 86:491-495 (1989).
RN [5]; RE0002619.
RX PUBMED: 2494701.
RA Turner R., Tjian R.
RT Leucine repeats and an adjacent DNA binding domain mediate the formation of functional cFos-cJun heterodimers
RL Science 243:1689-1694 (1989).
RN [6]; RE0002917.
RX PUBMED: 8264639.
RA Kataoka K., Noda M., Nishizawa M.
RT Maf nuclear oncoprotein recognizes sequences related to an AP-1 site and forms heterodimers with both Fos and Jun
RL Mol. Cell. Biol. 14:700-712 (1994).
RN [7]; RE0003146.
RX PUBMED: 2998035.
RA Cavalieri F., Ruscio T., Tinoco R., Benedict S., Davis C., Vogt P. K.
RT Isolation of three new Avian Sarcoma Viruses: ASV 9, ASV 17, and ASV 25
RL Virology 143:680-683 (1985).
RN [8]; RE0003147.
RX PUBMED: 3554236.
RA Vogt P.K., Bos T.J., Doolittle R.F.
RT Homologe between the DNA-binding domain of the GCN4 regulatory protein of yeast and the carboxyl-terminal region of a protein coded for by the oncogene jun
RL Proc. Natl. Acad. Sci. USA 84:3316-3319 (1987).
RN [9]; RE0003148.
RX PUBMED: 3033666.
RA Maki Y., Bos T.J., Davis C., Starbuck M., Vogt P.K.
RT Avian sarcoma virus 17 carries the jun oncogene
RL Proc. Natl. Acad. Sci. USA 84:2848-2852 (1987).
RN [10]; RE0004646.
RX PUBMED: 2835749.
RA Imler J. L., Ugarte E., Wasylyk C., Wasylyk B.
RT v-Jun is a transcriptional activator, but not in all cell-lines
RL Nucleic Acids Res. 16:3005-3012 (1988).
RN [11]; RE0004647.
RX PUBMED: 1584763.
RA Chida K., Vogt P. K.
RT Nuclear translocation of viral Jun but not of cellular Jun is cell cycle dependent
RL Proc. Natl. Acad. Sci. USA 89:4290-4294 (1992).
XX
//